Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR406 IGR404 IGR405 IGR408 IGR402 IGR410 IGR403 IGR407 IGR409 CPn0516 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0516 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0516 rsbv, - CPn0511 CPn0509 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0514 CPn0514 CPn0507 3mgh, - CPn0505 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0512

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
592553

Gene Stop:
594415

Gene Length:
1863

Molecular Weight*:
70229

pI*:
5.00

Net Charge*:
-20.60

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0512 is orthologously related to CT425, a hypothetical protein and they share 69% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MRRSVCYVNPSIARAGQISTWKFLYSLATPLPAGTKCKFDLAGSGKPTDW
EAPATDLSQTRNVIYAEMPEGEIIEATAIPVKDNPVPQFEFTLPYELQVG
ETLTIVMGASPNHPQVDDAGNGAQLFAQRRKPFYLYIDPTGEGNYDEPDV
FSMDIRGNVLKKIEIFTPSYVVKNKRFDITVRFEDEFGNLTNFSPEETRI
ELSYEHLRENLNWQLFIPETGFVILPNLYFNEPGIYRIQLKNLSTQEIFI
SAPIKCFADSAPNLMWGLLHGESERVDSEENIETCMRYFRDDRALNFYAS
SSFENQENLSPDIWKLINQTVSDFNEEDRFITLSGFQYSGEPHLEGVRHI
LHTKETKSHSKHKEYKHIPLAKLYKSTVNHDMISIPSFTASKEHGFDFEN
FYPEFERVVEIYNAWGSSETTAALNNPFPIQGKDSEDPRGTVIEGLKKNL
RFGFVAGGLDDRGIYKDYFDSPQVQYSPGLTAIICNKYTRESLVEALFAR
HCYATTGPRIVLSFNITSAPMGSELSTGSKPGLNVNRHISGHVAGTALLK
TVEIIRNGEVLHTFFPDSNNLDYEYDDMVPLSSVTLKDPNGKAPFVFYYL
RVTQADNAMAWSSPIWVDLN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGACGATCTGTTTGTTACGTTAACCCTTCGATAGCTCGAGCAGGGCA
AATTTCTACTTGGAAATTTCTTTATTCCCTTGCCACACCACTACCAGCTG
GAACCAAATGTAAATTTGACTTAGCAGGAAGTGGGAAACCCACAGATTGG
GAAGCCCCCGCGACAGATCTCTCCCAAACTAGAAACGTAATCTACGCAGA
AATGCCAGAAGGCGAAATCATCGAAGCAACCGCCATTCCTGTAAAAGACA
ATCCCGTTCCACAATTCGAGTTTACTCTCCCCTACGAACTTCAAGTAGGA
GAAACCCTCACTATTGTCATGGGAGCCTCTCCAAACCATCCTCAAGTCGA
TGATGCTGGGAACGGAGCCCAACTTTTCGCACAACGTCGCAAACCCTTTT
ACCTCTACATCGATCCTACAGGAGAAGGAAACTATGATGAACCCGATGTC
TTCTCTATGGATATCCGCGGAAACGTCCTAAAAAAAATAGAGATCTTTAC
TCCCTCCTATGTCGTTAAAAACAAACGCTTCGATATCACCGTGCGATTTG
AAGACGAATTCGGGAACCTCACCAACTTCTCTCCTGAAGAGACCCGAATC
GAGCTTTCCTACGAGCATCTTAGAGAAAATTTAAATTGGCAGCTCTTCAT
CCCAGAAACAGGCTTTGTTATTCTTCCTAATCTCTATTTCAATGAGCCTG
GAATTTATCGCATCCAATTGAAAAACCTCTCTACACAAGAAATTTTCATC
TCTGCCCCTATCAAATGTTTCGCTGACTCCGCCCCGAATCTTATGTGGGG
TCTCCTCCACGGCGAATCCGAACGCGTCGACTCTGAAGAAAATATTGAAA
CTTGTATGCGTTATTTCCGAGATGACCGCGCTCTGAATTTCTATGCTTCT
TCATCATTCGAAAATCAAGAGAACCTCTCTCCAGATATTTGGAAGCTCAT
CAATCAAACTGTCTCCGACTTTAATGAAGAAGATCGCTTCATCACACTAT
CCGGATTCCAATATAGCGGAGAACCTCATCTCGAGGGAGTGCGTCACATC
CTTCATACCAAGGAAACAAAGTCCCACTCGAAACACAAAGAATACAAACA
TATTCCCCTCGCCAAGCTCTATAAAAGCACTGTCAACCACGACATGATTT
CTATTCCTTCGTTCACAGCTTCTAAAGAACATGGTTTTGACTTTGAGAAT
TTCTACCCCGAGTTCGAAAGAGTTGTAGAAATTTATAATGCCTGGGGATC
TTCAGAAACCACAGCCGCTCTAAACAACCCCTTCCCTATCCAAGGTAAAG
ATAGCGAAGATCCTCGAGGTACAGTAATTGAAGGATTAAAGAAGAATCTC
CGCTTCGGATTTGTTGCTGGGGGTCTCGACGATCGAGGAATTTATAAAGA
CTACTTTGACTCTCCGCAAGTGCAATATTCCCCAGGGTTGACGGCTATCA
TTTGTAATAAATATACCCGAGAGTCTCTTGTTGAAGCTTTATTCGCACGT
CATTGCTACGCTACAACAGGACCTAGGATCGTCTTAAGCTTCAACATCAC
TTCAGCCCCTATGGGCTCCGAACTCTCCACAGGGTCGAAACCTGGACTCA
ACGTCAACCGTCACATCTCTGGTCATGTGGCAGGCACTGCCCTACTCAAG
ACTGTAGAAATCATCCGCAATGGCGAAGTTCTCCATACCTTCTTCCCCGA
TAGCAATAACCTGGACTATGAATACGATGATATGGTACCCCTAAGTTCAG
TGACCCTAAAAGATCCAAACGGTAAAGCACCTTTTGTATTCTACTATCTC
AGGGTCACTCAGGCAGACAATGCTATGGCCTGGAGTTCCCCAATCTGGGT
GGATTTAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy