Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR406 IGR404 IGR405 IGR408 IGR402 IGR410 IGR403 IGR407 IGR409 CPn0516 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0516 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0516 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 ubiE, - CPn0515 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0514 CPn0514 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0511

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rsbv  

Definition:
anti-sigma factor

Gene Start:
592141

Gene Stop:
592491

Gene Length:
351

Molecular Weight*:
12748

pI*:
5.90

Net Charge*:
-3.62

EC:
 

Functional Class:
transcription; transcription factors  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0511 is orthologously related to CT424: residues 1-114 of CPn0511 are 71% similar to residues 1-114 of CT424, an anti-sigma factor/sporulation-related protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1366
COG name: Anti-anti-sigma regulatory factor (sigma subunit antagonist)
Functional Class: T
The phylogenetic pattern of COG1366 is ------VC-BR------LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 3-95 are 38% similar to a defined domain of P73607, defined as: SPORULATION PROTEIN ANTI-SIGMA FACTOR ANTAGONIST PHOSPHORYLATION F STAGE II AA; position 8-108 are 19% similar to a defined domain of O69655_MYCTU, defined as HYPOTHETICAL 12.7 KD PROTEIN.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 107 (E-value = 1.4e-30) place CPn0511 in the STAS family which is described as STAS domain (PF01740)

PDB Hit:


Gene Protein Sequence:
MSDIQKEEHGSTTIFHLHGKLDGISSPEVQENISQSLAAGSKNIILDCAH
LDYMSSAGIRVLLQSYHQVGQHSGKIVLTTVPKTIEQTLYVTGFLSYFKI
FNTVDEAIQTLNKDGD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGATATCCAAAAAGAAGAACACGGCTCAACAACAATCTTTCATCT
CCACGGAAAACTTGATGGAATTTCTTCTCCAGAAGTACAAGAAAATATTT
CCCAATCCCTAGCAGCTGGATCCAAAAATATCATTCTCGACTGTGCTCAC
CTCGATTACATGTCCAGTGCAGGTATCCGAGTCCTACTGCAAAGCTACCA
TCAAGTAGGACAACATTCTGGGAAAATTGTCCTGACTACAGTCCCAAAAA
CCATAGAACAAACTCTCTATGTTACAGGATTCCTTTCTTACTTTAAAATA
TTCAATACTGTGGATGAAGCGATACAAACACTAAACAAAGACGGGGATTG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy