Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR406 IGR401 IGR404 IGR405 IGR408 IGR402 IGR403 IGR407 IGR409 IGR400 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 vacB, - CPn0504 CPn0514 CPn0514 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0510

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tlyC_2  

Definition:
CBS Domains (Hemolysin homolog)

Gene Start:
590813

Gene Stop:
591976

Gene Length:
1164

Molecular Weight*:
43967

pI*:
8.20

Net Charge*:
4.96

EC:
 

Functional Class:
cellular processes; toxin production and resistance  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to CBS domains and hemolysin sequences; e.g. residues 20-387 are 92% similar to (AE001636) CBS Domains (Hemolysin homolog) [Chlamydia pneumoniae]; residues 43-383 are 47% similar to (AE001316) (CBS Domain) [Chlamydia trachomatis]; residues 140-381 are 27% similar to (AE001119) hemolysin (tlyC) [Borrelia burgdorferi]; and residues 166-377 are 32% similar to (AE001239) hemolysin (tlyC) [Treponema pallidum].
BLAST also reveals significant similarity to MG146 and UU072, both of which are described as being similar to hemolysin.

CPn0510 is orthologously related to CT423: residues 1-383 of CPn0510 are 48% similar to residues 1-366 of CT423, a predicted conserved hypothetical protein (acidic) (hemolysin C) (tlyC) from C. trachomatis.
CPn0510 is also similar to TP0649, a predicted hemolysin from T. pallidum.
CPn0510 is somewhat similar to CT256 and MG146, predicted hemolysin-like proteins with CBS domains.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1253
COG name: Uncharacterized CBS domain-containing proteins
Functional Class: R
The phylogenetic pattern of COG1253 is -----QVCEBRHuj--OLINX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 244-172 and 170-269 are 57 and 32% similar respectively to a defined domain of O51086_BORBU defined as: PROTEIN TRANSMEMBRANE INTERGENIC REGION HEMOLYSIN CITA-SSPB MG146 HOMOLOG.

Paralogs:  Local Blast Search
A probable paralog in C.pneumoniae is CPn0394, a predicted CBS Domain protein (Hemolysin Homolog). Residues 151-377 of CPn0510 are 28% similar to residues 182-406 of CPn0394.

Pfam Summary:  Pfam Search
Residues 170 to 224 (E-value = 1.2e-10) place CPn0510 in the CBS family which is described as CBS domain (PF00571)
Residues 302 to 381 (E-value = 1.2e-22) place CPn0510 in the CorC_HlyC family which is described as Transporter associated domain (PF03471)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
1  
18
transmembrane  
53  
70
transmembrane  
87  
104
transmembrane  
117  
134

PDB Hit:


Gene Protein Sequence:
MLHILLAIFCILLFLAFGLTQPSCHGSSKFLKTLNQRFFKDKGREYPPFP
SAPTILATLLCILYGALGTKLYTLLPPKTAHKDLLFWPLYSLSALIAYGF
LPPWISTKVPKETTAHLRFLASVFQLGLFPLQLLFYRRRPNQQVRSSTSF
QSQLSEALSAFDNLIVREVMIPKVDIFALPEETTLQEALVLVSEEGYSRV
PVYKKNLDNITGILLVKDLLLLYTSSHDLSQPISSVAKPPFYAPEIKKAS
SLLQEFRQKHRHLAIIVNEYGFTEGIATMEDIIEEIIGEIADEHDVQENT
PYKKIGSSWIVDGRMNISDAEEYFNLKIDHENSYDTLGGHVFHKVGAVPQ
KGMRIHHENFDIEIITCTERNVGKLKITPRKRKFNIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCCATATTCTTTTAGCCATATTCTGTATTCTTCTATTCCTAGCCTT
CGGGCTTACGCAACCGTCCTGTCACGGATCCTCAAAATTCCTAAAAACCC
TAAACCAACGCTTCTTCAAAGATAAAGGAAGAGAGTATCCCCCCTTCCCC
AGTGCTCCTACAATTCTCGCCACGCTGCTCTGCATCCTCTATGGAGCTCT
CGGGACAAAACTCTATACCCTCCTCCCTCCAAAAACAGCTCACAAAGATC
TCCTATTCTGGCCCCTATACTCTCTAAGCGCCCTGATAGCTTACGGATTC
CTCCCCCCATGGATCTCTACAAAAGTCCCTAAAGAAACCACCGCCCACCT
CCGTTTTCTAGCTTCGGTATTCCAACTCGGTCTCTTCCCACTGCAACTGC
TCTTTTACAGACGCCGCCCTAACCAACAAGTACGATCTTCAACATCATTT
CAAAGCCAGCTCTCCGAAGCCCTCTCCGCTTTTGATAACCTCATTGTCCG
TGAAGTCATGATCCCAAAAGTAGATATTTTCGCACTTCCCGAAGAAACTA
CACTACAAGAAGCTCTGGTTCTCGTAAGCGAAGAAGGCTACAGTCGCGTT
CCCGTTTATAAAAAAAACTTAGACAACATCACAGGAATCCTTCTTGTTAA
AGATCTCTTACTGCTCTATACAAGCAGCCACGACCTCAGCCAACCCATAT
CCTCAGTAGCAAAACCCCCATTCTATGCCCCAGAAATAAAAAAAGCCTCC
TCTCTTCTCCAAGAGTTCCGACAAAAACATCGCCATCTAGCCATCATAGT
CAATGAATACGGATTCACAGAAGGCATCGCTACCATGGAAGATATTATCG
AAGAAATTATAGGAGAGATCGCAGACGAGCACGACGTACAAGAAAATACT
CCTTATAAGAAAATCGGAAGCTCTTGGATTGTAGATGGAAGAATGAATAT
CTCCGACGCTGAAGAGTACTTCAATTTGAAAATCGATCATGAAAATAGCT
ACGATACACTAGGAGGACATGTCTTCCATAAAGTGGGTGCTGTTCCCCAA
AAAGGAATGCGTATCCATCACGAAAACTTCGATATAGAAATCATTACCTG
CACAGAACGAAATGTCGGAAAACTAAAAATCACACCAAGAAAACGTAAAT
TCAATATCTCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy