Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR406 IGR401 IGR404 IGR405 IGR408 IGR402 IGR403 IGR407 IGR409 IGR400 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 CPn0513 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0507

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
589961

Gene Stop:
590125

Gene Length:
165

Molecular Weight*:
6126

pI*:
12.30

Net Charge*:
13.45

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0507 is orthologously related to CT421.1, a hypothetical protein and they share 64% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTRMSKQARRRAKSPKKRKPKYAIVHPAPAPRIVYKLHTNALSTSDSIFI
PKIG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACGAATGAGTAAACAAGCTCGGCGCAGAGCGAAAAGTCCTAAAAA
ACGTAAACCTAAGTATGCCATTGTGCATCCAGCGCCAGCTCCAAGAATTG
TATATAAATTGCATACGAATGCATTGAGCACCAGTGATAGCATTTTTATC
CCGAAAATAGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy