Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR406 IGR401 IGR404 IGR405 IGR408 IGR402 IGR403 IGR407 IGR409 IGR400 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0506

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
589172

Gene Stop:
589843

Gene Length:
672

Molecular Weight*:
24779

pI*:
8.60

Net Charge*:
4.47

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0506 is weakly similar to an unknown protein (AC006081) in Arabidopsis thaliana.

CPn0506 is orthologously related to CT421, a predicted hypothetical protein.
Residues 19-227 are 81% similar to CT421.



COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 48 to 209 (E-value = 1.4e-72) place CPn0506 in the DUF502 family which is described as Protein of unknown function (DUF502) (PF04367)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
11  
28
transmembrane  
57  
81
transmembrane  
86  
103

PDB Hit:


Gene Protein Sequence:
MKKYFITGLVILLPLAITIAIVTMIMNFLTQPFVGLASEFFEKFSFYTKH
RALLKFVLQIILLFGLFFATVLLGFLTRIMIFKSLLSIYDKILHRIPIIK
TVYKAAQQVMTTIFGSKSGSFKQVVMVPFPNANVQCIGLVAGDAPTVCCT
GEKEDDPLVTVFIPTTPNPTSGFLTLFRKSDIVFLDMKIEDAFKYIISCG
VLSTPMACPSSPLPDELHQDQGS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATACTTTATTACAGGACTTGTTATTCTCCTTCCTCTAGCAAT
TACTATTGCTATTGTTACTATGATCATGAACTTCCTAACCCAACCCTTCG
TAGGCTTGGCTTCGGAATTCTTTGAGAAATTTAGCTTTTATACTAAACAT
AGAGCTCTTCTAAAATTCGTATTGCAAATCATTTTACTCTTCGGTCTCTT
TTTCGCCACAGTGCTCCTAGGTTTCCTCACGAGAATTATGATTTTTAAAT
CCCTACTCTCTATCTACGACAAAATCTTACACCGAATTCCCATCATTAAA
ACAGTGTATAAAGCTGCGCAACAAGTCATGACTACCATATTTGGATCAAA
ATCAGGATCCTTCAAACAAGTAGTTATGGTTCCTTTCCCTAACGCAAATG
TTCAATGCATCGGTCTCGTCGCTGGAGACGCACCCACAGTATGCTGCACA
GGAGAAAAGGAAGACGACCCCCTCGTCACGGTCTTCATCCCAACAACACC
CAACCCCACCTCAGGGTTTCTTACCCTATTTAGAAAATCTGATATCGTAT
TCCTAGATATGAAAATCGAAGATGCTTTCAAATATATTATCTCCTGTGGA
GTCCTCTCAACCCCCATGGCATGCCCCTCGTCTCCCCTCCCTGACGAGCT
ACACCAAGATCAAGGCAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy