Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR406 IGR404 IGR399 IGR405 IGR408 IGR402 IGR403 IGR407 IGR400 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 grpE, - CPn0502 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 grpE, - CPn0502 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 rsbv, - CPn0511 CPn0509 grpE, - CPn0502 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 CPn0512 dnaK, - CPn0503 vacB, - CPn0504 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0505

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
3mgh  

Definition:
3-methyladenine DNA glycosylase

Gene Start:
588519

Gene Stop:
589109

Gene Length:
591

Molecular Weight*:
22243

pI*:
9.20

Net Charge*:
5.78

EC:
 

Functional Class:

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits to DNA-3-methyladenine glycosidase sequences; e.g. residues 7-184 are 43% similar to 3MGH_BACSU; residues 4-186 are 38% similar to 3MGH_BORBU; residues 7-184 are 36% similar to 3MG_MOUSE; residues 7-187 are 39% similar to 3MG_ARATH; residues 7-184 are 35% similar to 3MG_RAT; and residues 7-184 are 34% similar to 3MG_HUMAN.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG2094
COG name: 3-methyladenine DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG2094 is ---------br-----o--nx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-184 are 44% similar to a defined domain of 3MGH_BACSU, defined as: DNA GLYCOSYLASE GLYCOSIDASE 3-METHYLADENINE REPAIR HYDROLASE PROTEIN PUTATIVE DNA-3-METHYLADENINE ADPG.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 191 (E-value = 1.2e-122) place CPn0505 in the Pur_DNA_glyco family which is described as Methylpurine-DNA glycosylase (MPG) (PF02245)

PDB Hit:


Gene Protein Sequence:
VLQEHFFLSEDVITLAQQLLGHKLITTHEGLITSGYIVETEAYRGPDDKA
CHAYNYRKTQRNRAMYLKGGSAYLYRCYGMHHLLNVVTGPEDIPHAVLIR
AILPDQGKELMIQRRQWRDKPPHLLTNGPGKVCQALGISLENNRQRLNTP
ALYISKEKISGTLTATARIGIDYAQEYRDVPWRFLLSPEDSGKVLS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTACAAGAACATTTTTTTCTATCGGAAGATGTAATTACACTAGCGCA
ACAGCTTTTAGGACATAAACTCATCACAACACATGAGGGTCTGATAACTT
CAGGTTACATTGTAGAAACCGAAGCGTATCGTGGCCCTGATGACAAAGCA
TGCCACGCCTACAACTACAGAAAAACTCAGAGGAACAGAGCGATGTACCT
GAAAGGAGGCTCTGCTTACCTCTACCGTTGCTATGGCATGCATCACCTAT
TGAATGTTGTCACTGGACCTGAGGACATTCCCCATGCCGTCCTGATCCGG
GCCATCCTTCCTGATCAAGGCAAAGAACTTATGATCCAACGCCGCCAATG
GAGAGATAAACCCCCACACCTTCTCACCAATGGACCCGGAAAAGTGTGCC
AAGCTCTAGGAATCTCTTTGGAAAACAATAGGCAACGCCTAAATACCCCA
GCTCTCTATATCAGCAAAGAAAAAATCTCTGGGACTCTAACAGCAACTGC
CCGGATCGGCATCGATTATGCTCAAGAGTATCGTGATGTCCCATGGAGAT
TTCTCCTATCCCCAGAAGATTCGGGAAAAGTTTTATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy