Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR406 IGR404 IGR399 IGR405 IGR408 IGR402 IGR403 IGR407 IGR400 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 hrcA, - CPn0501 dnaK, - CPn0503 vacB, - CPn0504 CPn0508 CPn0507 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 hrcA, - CPn0501 dnaK, - CPn0503 vacB, - CPn0504 rsbv, - CPn0511 CPn0509 3mgh, - CPn0505 CPn0506 tlyC_2, - CPn0510 hrcA, - CPn0501 dnaK, - CPn0503 vacB, - CPn0504 grpE, - CPn0502 grpE, - CPn0502 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0504

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
vacB  

Definition:
ribonuclease II (VACB-related)

Gene Start:
586487

Gene Stop:
588517

Gene Length:
2031

Molecular Weight*:
76328

pI*:
9.50

Net Charge*:
16.26

EC:
3.1.13.1  

Functional Class:
transcription; degration of RNA  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0504 is orthologously related to CT397: residues 6-669 of CPn0504 are 68% similar to residues 3-664 of CT397, a predicted vacB ribonuclease II from C. trachomatis.
CPn0504 is similar to UU057, MG104, TP0805.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0557
COG name: Exoribonucleases
Functional Class:  K
The phylogenetic pattern of COG0557 is ----YqvCEb-Hujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 126 to 492 (E-value = 9.2e-164) place CPn0504 in the RNB family which is described as RNB-like protein (PF00773)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
602  
676

PDB Hit:


Gene Protein Sequence:
LLKKPKRKPGRRTYGKSLKIFIPGTLFVHARKGFGFVSPDNPEEYPFDIF
VPARDLRGALDGDHVIVSVLPYPRDGQKLKGTISEVLARGKTTLVGTITS
LVSPTSALAYTSMSGSQSLIPVELLPGRTYKIGDRILLSTPPWVDKPQEG
ASPALQMLEFIGHITNAKADFQAIQAEYNLAEEFPPEVIEEASLFSQKHI
TQVLHSRKDLRDLLCFTIDSSTARDFDDAISLTYDHNNNYILGVHIADVS
HYVTPHSHLDKEAAKRCNSTYFPGKVIPMLPSALSDNLCSLKPNVDRLAV
SVFMTFTKSGHLSDYQIFRSVIRSKYRMTYDEVDNIIEKKHSHPLSKILN
EMATLSKKFSDIREERGCIRFVLPSVTMSLDNLQEPVALIENHQTFSHKL
IEEFMLKANEVVAYHISHQGVSLPFRSHEPPNDENLLAFQELAKNMGFDI
TFTPTQEPDYQYLLQTTSAGHPLEQVLHSQFVRSMKTASYSTENKGHYGL
KLDYYTHFTSPIRRYIDLIVHRLLFNPLSIDQTHLEIIVRACSTKERVSA
KAENSFENLKKTRFINKFLQEQPKTTYHAYIITANHEGLSFVVTEFCHEG
FIAAAELPKEYSLKKNALPESIPDKMKPGASIKVTIDSVNLLTQKIVWSI
ATTTEDKPKKIKKTPSKKKGTKKRAS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTGAAAAAACCAAAAAGAAAACCAGGGAGAAGAACATACGGTAAATC
CTTGAAGATTTTTATTCCAGGAACCCTATTTGTTCATGCTAGAAAAGGTT
TCGGTTTTGTTTCTCCCGACAACCCCGAAGAATACCCATTTGATATTTTT
GTTCCCGCCCGAGATTTACGCGGGGCTCTAGATGGTGACCACGTGATTGT
CTCCGTGCTTCCCTATCCAAGAGACGGACAAAAACTCAAAGGCACTATCA
GCGAAGTACTCGCAAGAGGAAAAACAACACTCGTAGGAACGATCACCTCA
CTAGTCAGTCCCACATCAGCACTTGCCTACACAAGCATGTCGGGATCCCA
ATCTTTAATTCCAGTAGAACTCCTTCCCGGACGCACTTACAAAATCGGCG
ATCGCATTCTTCTGAGCACTCCTCCCTGGGTAGATAAACCCCAAGAAGGA
GCCTCTCCAGCCTTACAAATGCTCGAATTTATTGGCCACATCACCAACGC
TAAAGCGGACTTTCAGGCAATTCAAGCCGAATATAACCTTGCCGAAGAAT
TCCCCCCAGAGGTCATTGAAGAAGCAAGCCTTTTCTCTCAAAAACACATT
ACCCAAGTTCTCCACTCTCGCAAAGATCTCCGTGATCTCCTCTGTTTCAC
CATAGACTCTTCCACAGCCAGAGACTTCGACGATGCCATCTCCCTCACCT
ACGATCATAATAACAATTACATTCTTGGTGTACACATCGCAGACGTCTCC
CACTACGTTACCCCACATTCTCACCTAGACAAAGAAGCTGCTAAACGCTG
TAACTCTACATATTTCCCAGGGAAAGTCATTCCCATGTTGCCATCAGCAC
TCTCTGATAATCTCTGCAGCTTAAAACCAAACGTTGATAGACTCGCTGTA
TCCGTATTTATGACGTTTACAAAATCAGGTCATCTTTCAGATTACCAGAT
TTTCCGTAGCGTCATTCGAAGCAAATATCGTATGACCTACGATGAAGTCG
ATAACATCATTGAAAAGAAACACTCCCACCCCCTCTCAAAAATCCTCAAT
GAGATGGCCACTCTAAGTAAAAAGTTTTCCGATATCCGTGAAGAACGTGG
TTGCATTCGCTTTGTCCTCCCCTCAGTCACTATGTCCTTGGATAATCTTC
AAGAACCCGTAGCTCTGATAGAAAACCACCAGACCTTCTCCCATAAACTC
ATCGAAGAGTTTATGCTTAAAGCAAACGAAGTGGTCGCCTATCATATCTC
CCATCAAGGCGTTTCTCTACCTTTTCGTAGTCACGAACCTCCCAATGATG
AAAACCTACTCGCCTTCCAAGAATTGGCAAAAAACATGGGCTTTGATATC
ACGTTCACTCCCACACAAGAACCTGATTACCAATACCTTTTGCAAACTAC
GTCAGCAGGACATCCCCTAGAGCAAGTTCTACACTCGCAGTTTGTCCGAA
GTATGAAAACAGCCTCCTACTCTACAGAAAATAAAGGTCATTACGGACTT
AAGCTCGACTACTACACCCACTTTACGAGTCCCATACGTAGATATATCGA
TCTTATTGTTCACAGGCTTCTCTTCAACCCCCTATCTATAGACCAAACGC
ACCTCGAAATTATCGTAAGAGCATGCTCTACAAAAGAACGAGTATCCGCA
AAAGCAGAAAATTCTTTCGAAAACCTCAAAAAAACTCGGTTCATAAATAA
ATTTTTGCAAGAGCAACCTAAAACTACATACCATGCGTATATCATCACTG
CAAATCATGAAGGACTCTCATTTGTAGTGACCGAATTCTGCCATGAAGGG
TTCATTGCAGCAGCAGAACTCCCTAAAGAATATTCCCTAAAGAAAAACGC
TCTTCCAGAATCTATCCCAGATAAAATGAAACCTGGAGCTTCTATAAAAG
TCACTATTGATTCCGTGAATCTCCTTACGCAAAAAATCGTCTGGTCTATA
GCGACAACCACAGAAGATAAACCTAAGAAAATAAAGAAAACGCCTTCTAA
GAAAAAAGGAACGAAAAAAAGAGCCTCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy