Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR404 IGR399 IGR402 IGR398 IGR403 IGR400 IGR397 CPn0499 CPn0508 CPn0507 3mgh, - CPn0505 CPn0506 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0499 CPn0508 CPn0507 3mgh, - CPn0505 CPn0506 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0499 3mgh, - CPn0505 CPn0506 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 grpE, - CPn0502 grpE, - CPn0502 CPn0507 CPn0508
* Calculated from Protein Sequence

Gene ID: CPn0503

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaK  

Definition:
heat shock protein-70

Gene Start:
584234

Gene Stop:
586216

Gene Length:
1983

Molecular Weight*:
71346

pI*:
4.80

Net Charge*:
-23.30

EC:
 

Functional Class:
protein fate; protein folding and stabilization  
regulatory functions  

Pathway: pathway table

Primary Evidence:
Birkelund,S., Lundemose,A.G. and Christiansen,G. The 75-kilodalton cytoplasmic Chlamydia trachomatis L2 polypeptide is a DnaK-like protein. Infect. Immun. 58 (7): 2098-2104 (1990).

Danilition,S.L., Maclean,I.W., Peeling,R., Winston,S. and Brunham,R.C. The 75-kilodalton protein of Chlamydia trachomatis: a member of the heat shock protein 70 family? Infect. Immun. 58 (1): 189-196 (1990).

Schmiel DH and Wyrick PB. 1994. Another putative heat-shock gene and aminoacyl-transfer-RNA synthetase gene are located upstream from the grpE-like and dnaK-like genes in Chlamydia trachomatis. Gene 145(1): 57-63.

Tan M, Wong B, Engel JN. 1996. Transcriptional organization and
regulation of the dnaK and groE operons of Chlamydia trachomatis. J. Bacteriology 178(23): 6983-6990.

Comment:
DnaK, or HSP70, acts as a chaperone early in infection. See CPn0032 for the DnaJ protein in C. pneumoniae.

From Prosite PDOC00269:

Prokaryotic and eukaryotic organisms respond to heat shock or other environmental stress by the induction of the synthesis of proteins collectively known as heat-shock proteins (hsp). Amongst them is a family of proteins with an average molecular weight of 70 kD, known as the hsp70 proteins. In most species, there are many proteins that belong to the hsp70 family. Some of them are
expressed under unstressed conditions. Hsp70 proteins can be found in different cellular compartments (nuclear, cytosolic, mitochondrial, endoplasmic reticulum, etc.). Some of the hsp70 family proteins are listed below:

- In Escherichia coli and other bacteria, the main hsp70 protein is known as the dnaK protein. A second protein, hscA, has been recently discovered. DnaK is also found in the chloroplast genome of red algae.
- In yeast, at least ten hsp70 proteins are known to exist: SSA1 to SSA4, SSB1, SSB2, SSC1, SSD1 (KAR2), SSE1 (MSI3) and SSE2.
- In Drosophila, there are at least eight different hsp70 proteins: HSP70, HSP68, and HSC-1 to HSC-6.
- In mammals, there are at least eight different proteins: HSPA1 to HSPA6, HSC70, and GRP78 (also known as the immunoglobulin heavy chain binding protein (BiP)).
- In the sugar beet yellow virus (SBYV), a hsp70 homolog has been shown to exist.
- In archaebacteria, hsp70 proteins are also present.

All proteins belonging to the hsp70 family bind ATP. A variety of functions has been postulated for hsp70 proteins. It now appears that some hsp70 proteins play an important role in the transport of proteins across membranes. They also seem to be involved in protein folding and in the assembly/disassembly of protein
complexes.

Blast Summary:  PSI-Blast Search
CPn0503 is orthologously related to CT396: residues 1-659 of CPn0503 are 86% similar to residues 1-660 of CT396, DnaK protein (HSP70) from C. trachomatis.
CPn0503 is also similar to TP0216, UU339, MG305.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0443
COG name: Molecular chaperones (HSP70/DnaK family)
Functional Class: O
The phylogenetic pattern of COG0443 is --t-YQvCEbRHujgpOlinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 388 (E-value = 1.1e-05) place CPn0503 in the MreB_Mbl family which is described as MreB/Mbl protein (PF06723)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
159  
235
coil-coil  
243  
277
non-globular  
334  
412
coil-coil  
507  
596

PDB Hit:


Gene Protein Sequence:
MSEHKKSSKIIGIDLGTTNSCVSVMEGGQAKVITSSEGTRTTPSIVAFKG
NEKLVGIPAKRQAVTNPEKTLGSTKRFIGRKYSEVASEIQTVPYTVTSGS
KGDAVFEVDGKQYTPEEIGAQILMKMKETAEAYLGETVTEAVITVPAYFN
DSQRASTKDAGRIAGLDVKRIIPEPTAAALAYGIDKVGDKKIAVFDLGGG
TFDISILEIGDGVFEVLSTNGDTLLGGDDFDEVIIKWMIEEFKKQEGIDL
SKDNMALQRLKDAAEKAKIELSGVSSTEINQPFITMDAQGPKHLALTLTR
AQFEKLAASLIERTKSPCIKALSDAKLSAKDIDDVLLVGGMSRMPAVQET
VKELFGKEPNKGVNPDEVVAIGAAIQGGVLGGEVKDVLLLDVIPLSLGIE
TLGGVMTTLVERNTTIPTQKKQIFSTAADNQPAVTIVVLQGERPMAKDNK
EIGRFDLTDIPPAPRGHPQIEVSFDIDANGIFHVSAKDVASGKEQKIRIE
ASSGLQEDEIQRMVRDAEINKEEDKKRREASDAKNEADSMIFRAEKAIKD
YKEQIPETLVKEIEERIENVRNALKDDAPIEKIKEVTEDLSKHMQKIGES
MQSQSASAAASSAANAKGGPNINTEDLKKHSFSTKPPSNNGSSEDHIEEA
DVEIIDNDDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGAACACAAAAAATCAAGCAAAATTATAGGTATAGACTTAGGCAC
AACAAACTCCTGCGTATCTGTTATGGAAGGAGGACAAGCTAAAGTAATTA
CATCATCCGAAGGAACAAGAACCACGCCATCGATCGTTGCCTTCAAAGGT
AATGAGAAATTAGTGGGGATTCCAGCAAAACGTCAAGCAGTGACAAATCC
AGAAAAAACTCTCGGCTCTACAAAACGCTTTATTGGCCGTAAGTACTCTG
AAGTAGCTTCGGAAATCCAAACCGTTCCTTATACAGTCACCTCCGGATCT
AAAGGTGATGCCGTTTTCGAAGTTGATGGCAAACAATACACTCCAGAAGA
AATTGGCGCACAAATCTTAATGAAAATGAAAGAGACAGCAGAAGCTTATC
TAGGCGAAACTGTCACAGAAGCAGTGATCACCGTCCCCGCATACTTCAAT
GATTCTCAACGAGCATCCACAAAAGATGCTGGACGCATTGCAGGTCTAGA
TGTAAAACGTATCATTCCAGAACCTACCGCAGCAGCTCTTGCCTACGGAA
TCGATAAAGTCGGTGATAAAAAAATCGCTGTCTTCGACCTTGGTGGAGGA
ACTTTTGATATCTCCATCCTAGAAATCGGTGATGGCGTCTTCGAAGTTCT
ATCTACAAATGGAGATACTCTCCTCGGTGGAGACGACTTTGATGAAGTCA
TTATCAAATGGATGATCGAAGAATTCAAAAAACAAGAAGGCATTGATCTT
AGCAAAGATAATATGGCCTTACAAAGACTTAAAGATGCTGCTGAGAAAGC
AAAAATAGAACTTTCAGGAGTCTCTTCCACAGAAATCAATCAGCCATTCA
TCACAATGGATGCACAAGGACCTAAACACCTTGCATTGACACTCACACGT
GCGCAATTCGAGAAACTCGCAGCCTCTCTAATCGAAAGAACAAAATCTCC
ATGCATCAAAGCACTCAGTGACGCAAAACTTTCCGCTAAGGATATCGATG
ATGTTCTCTTAGTTGGAGGTATGTCAAGAATGCCCGCAGTGCAAGAAACT
GTAAAAGAACTCTTCGGCAAAGAGCCTAATAAAGGAGTCAACCCCGACGA
AGTTGTTGCTATTGGAGCCGCAATTCAAGGTGGTGTTCTTGGCGGAGAAG
TTAAGGATGTTCTACTTCTAGACGTTATCCCCCTATCTCTGGGTATCGAA
ACTCTAGGAGGCGTCATGACGACTCTGGTAGAGAGAAATACTACAATCCC
TACACAGAAAAAACAAATCTTCTCCACAGCTGCTGATAACCAGCCTGCGG
TTACCATCGTAGTTCTCCAAGGAGAGCGTCCCATGGCCAAAGATAACAAG
GAAATCGGAAGATTCGATCTTACAGATATCCCTCCGGCTCCTCGAGGCCA
TCCTCAAATCGAAGTCTCCTTCGATATCGATGCAAACGGAATTTTCCATG
TCTCAGCTAAAGATGTTGCCAGCGGTAAAGAACAGAAAATTCGTATCGAA
GCAAGCTCAGGACTTCAAGAAGATGAAATCCAAAGAATGGTTCGAGATGC
CGAAATTAATAAGGAAGAAGATAAAAAACGTCGTGAAGCTTCAGATGCTA
AAAATGAAGCCGATAGCATGATCTTCAGAGCCGAAAAAGCTATTAAAGAT
TATAAGGAGCAAATTCCTGAAACTTTAGTTAAAGAAATCGAAGAGCGAAT
CGAAAACGTGCGCAACGCACTCAAAGATGACGCTCCTATTGAAAAAATTA
AAGAGGTTACTGAAGACCTAAGCAAGCATATGCAAAAAATTGGAGAGTCT
ATGCAATCGCAGTCTGCATCAGCAGCAGCATCATCGGCAGCCAATGCTAA
AGGTGGACCTAACATCAATACAGAAGATTTGAAAAAACATAGTTTCAGTA
CGAAGCCTCCTTCAAATAACGGTTCTTCAGAAGACCATATCGAAGAAGCT
GATGTAGAAATTATTGATAACGACGATAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy