Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR401 IGR399 IGR398 IGR396 IGR400 IGR397 CPn0498 CPn0499 3mgh, - CPn0505 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0498 CPn0499 3mgh, - CPn0505 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0499 CPn0498 3mgh, - CPn0505 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 grpE, - CPn0502 grpE, - CPn0502
* Calculated from Protein Sequence

Gene ID: CPn0502

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
grpE  

Definition:
HSP-70 cofactor

Gene Start:
583650

Gene Stop:
584204

Gene Length:
555

Molecular Weight*:
21276

pI*:
4.70

Net Charge*:
-11.25

EC:
 

Functional Class:
cellular processes; chaperones  

Pathway: pathway table

Primary Evidence:
Schmiel DH and Wyrick PB. 1994. Another putative heat-shock gene and aminoacyl-transfer-RNA synthetase gene are located upstream from the grpE-like and dnaK-like genes in Chlamydia trachomatis. Gene 145(1): 57-63.

Tan M, Wong B, Engel JN. 1996. Transcriptional organization and regulation of the dnaK and groE operons of Chlamydia trachomatis. J. Bacteriology 178(23): 6983-6990.

Comment:
In Bacillus, the GrpE function is in support of DnaK, facilitating ATPase activity and recycling of the latter. See Herbort et al., GENE 170:81 (1996). A parallel activity seems to be present in eukaryotes.

From Prosite PDOC00822:

In prokaryotes the GrpE protein stimulates, jointly with DnaJ, the ATPase activity of the DnaK chaperone. It seems to accelerate the release of ADP from DnaK thus allowing DnaK to recycle more efficiently. GrpE is a protein of about 22 to 25 Kd. In yeast, an evolutionary related mitochondrial protein (gene GRPE) has been shown to associate with the mitochondrial hsp70 protein and to thus play a role in the import of proteins from the cytoplasm.

Blast Summary:  PSI-Blast Search
CPn0502 is orthlogously related to CT395: residues 1-177 of CPn0502 are 71% similar to residues 1-178 of CT395, a predicted GrpE-related chaperonin from C. trachomatis. CPn0502 is also similar to TP0215, a predicted grpE protein from T. pallidum.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0576
COG name: Molecular chaperone GrpE (heat shock protein)
Functional Class:  O
The phylogenetic pattern of COG0576 is --t-yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 175 (E-value = 2.2e-65) place CPn0502 in the GrpE family which is described as GrpE (PF01025)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
93

PDB Hit:


Gene Protein Sequence:
MTDTPPENEEQHESNVQNENEVEHLQQEIVTLKTELKEKNDKYLMALAES
ENSRKRLQKERQELMQYALENTLIDFLNPIESMEKALGFATQMSDDVKNW
ALGFNMILNQFKQIFEEKGIIEYSSIGQKFNPFLHEAVQTEETSEVPEGT
ILEEFAKGYKIGERPIRVAKVKVAKAPTPKENKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGATACCCCACCTGAAAATGAGGAACAACACGAAAGCAATGTTCA
AAACGAAAATGAAGTTGAACATTTGCAACAGGAAATCGTCACCCTAAAAA
CCGAATTAAAAGAAAAAAACGATAAGTATCTCATGGCTCTAGCAGAATCT
GAGAATTCTAGAAAACGCTTACAAAAAGAACGCCAAGAACTTATGCAGTA
TGCTTTAGAAAATACTTTAATAGACTTTCTCAATCCCATAGAAAGCATGG
AGAAAGCCCTCGGATTTGCTACACAAATGTCCGACGATGTAAAAAATTGG
GCCCTCGGATTCAACATGATTCTCAACCAATTCAAACAAATCTTCGAGGA
AAAAGGTATTATTGAATATTCTTCAATAGGCCAAAAGTTTAACCCCTTCC
TACACGAAGCGGTGCAAACAGAAGAGACTTCTGAAGTTCCTGAGGGGACG
ATTTTAGAAGAGTTTGCAAAGGGATATAAAATAGGAGAACGCCCGATTCG
GGTAGCTAAAGTTAAAGTCGCTAAAGCTCCTACTCCCAAAGAAAATAAAG
AATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy