Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR399 IGR398 IGR396 IGR400 IGR397 CPn0498 CPn0499 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0498 CPn0499 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 CPn0498 CPn0499 CPn0497 CPn0497 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 vacB, - CPn0504 grpE, - CPn0502 grpE, - CPn0502
* Calculated from Protein Sequence

Gene ID: CPn0501

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hrcA  

Definition:
HTH transcriptional repressor; negative regulator of class I heat shock genes

Gene Start:
582457

Gene Stop:
583653

Gene Length:
1197

Molecular Weight*:
45144

pI*:
7.30

Net Charge*:
0.91

EC:
 

Functional Class:
regulatory functions  

Pathway: pathway table

Primary Evidence:
Tan M, Wong B, Engel JN. 1996. Transcriptional organization and regulation of the dnaK and groE operons of Chlamydia-trachomatis. J. Bacteriology 178(23): 6983-6990.

Comment:
HrcA is a negative regulator of class I heat shock genes (GrpE-DnaK-DnaJ and GroELs operons). Prevents heat-shock induction of these operons (by similarity).


Blast Summary:  PSI-Blast Search
CPn0501 is orthologously related to CT394: residues 11-396 of CPn0501 are 62% similar to residues 5-390 of CT394, a heat-inducible transcription represor, hrcA. CPn0501 is also similar to MG205, UU421.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1420
COG name: Transcriptional regulators of heat shock genes HrcA
Functional Class:  K
The phylogenetic pattern of COG1420 is ------vc-br-ujgp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 22-211 are 63% similar to a HrcA heat shock repressor domain of HRC1_CHLTR. Residues 241-339 are 68% similar to a HrcA heat shock repressor domain of O84399_CHLTR


Paralogs:  Local Blast Search
No paralog in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 123 to 341 (E-value = 1.5e-79) place CPn0501 in the HrcA family which is described as HrcA protein C terminal domain (PF01628)

PDB Hit:


Gene Protein Sequence:
MLSVTIVLVGLEMARSKVSKRDSKILDILFATTELYLKTGQPVGSKTLKE
SFCSDLSTATIRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVDHQEEC
PEAEISAPIFDKISQLPSESRNIIKDLQKATELLGEILDLPTFFSSPRFE
NDSVTNIQITQVDKQRAVTILSTEFGQIFTDTLWLPEACDTLSIKRIEKF
LQNYIRKLPTNEELSKKEEHLSMSLYNEVVVRYLTRYCNFSEEDLYQTGM
SKLLKYEAFKDPEVLALGLSLFENRRQMCELLNIGMHKGRATAFIGKELS
DILGTSNPGCSVITIPYYMNRSPLGALGILGPINLPYKEALPLLKLFANK
INETLTQSFYKFKLSFRRPLTSNCKLSNEPILRTEYSSIKLLPSKETL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTCAGTTACGATTGTTCTAGTAGGACTCGAGATGGCTAGATCCAA
AGTCTCAAAGCGAGATTCAAAAATCCTTGATATCCTGTTTGCTACAACAG
AGTTGTACCTAAAAACAGGGCAGCCTGTAGGGTCTAAAACTTTAAAGGAA
AGTTTTTGCTCTGATTTGAGTACGGCAACTATAAGAAATTACTTTGCAGA
ACTTGAAGCTGAAGGATTCTTAAAAAAAAATCATACTTCCGGAGGAAGAA
TCCCTACAGACCTAGCATTACGTCACTATGTAGATCACCAAGAAGAATGC
CCAGAAGCTGAGATTTCTGCCCCCATTTTTGATAAGATCAGTCAGCTTCC
TAGCGAAAGTCGCAATATTATCAAGGATCTACAAAAAGCTACGGAACTTC
TTGGAGAAATCCTAGACCTGCCTACGTTTTTTTCTTCCCCACGCTTTGAA
AATGATTCCGTAACCAATATTCAAATTACACAGGTCGATAAGCAAAGAGC
TGTCACCATCCTCTCTACGGAGTTTGGTCAGATCTTCACAGACACCCTAT
GGCTGCCTGAAGCTTGCGATACTCTTTCTATCAAACGTATAGAAAAATTC
CTGCAGAACTACATCCGAAAGCTCCCCACAAATGAGGAACTTTCGAAAAA
AGAAGAACACCTGAGCATGTCCCTCTATAATGAGGTGGTTGTCCGCTATC
TAACACGCTACTGCAACTTTAGTGAAGAAGATCTCTATCAAACAGGAATG
TCGAAACTACTGAAATACGAAGCGTTTAAAGATCCTGAAGTTCTAGCTCT
AGGACTCTCTCTTTTTGAAAATCGCAGACAAATGTGTGAGCTTCTAAATA
TAGGAATGCATAAAGGAAGAGCTACAGCGTTCATAGGGAAGGAGCTTTCT
GATATTTTAGGGACCTCGAATCCAGGATGTTCTGTAATTACTATTCCCTA
TTATATGAATCGCTCTCCACTCGGAGCTTTAGGTATCCTAGGCCCGATCA
ATCTTCCTTATAAGGAAGCTCTTCCTTTGCTCAAACTATTTGCGAATAAA
ATAAATGAAACCCTGACACAAAGTTTCTACAAATTTAAACTATCCTTCAG
AAGACCACTCACCTCTAACTGTAAGCTTTCGAATGAGCCTATTTTAAGAA
CGGAGTACTCTTCTATAAAACTATTACCCTCTAAGGAGACGTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy