Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR399 IGR392 IGR398 IGR393 IGR396 IGR394 IGR397 CPn0493 CPn0494 CPn0498 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 CPn0493 CPn0494 CPn0498 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 CPn0494 CPn0498 CPn0499 CPn0497 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 dnaK, - CPn0503 grpE, - CPn0502 CPn0496 grpE, - CPn0502 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0499

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
580359

Gene Stop:
579202

Gene Length:
1158

Molecular Weight*:
42474

pI*:
4.60

Net Charge*:
-23.82

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0499 is weakly similar to CT392, a predicted hypothetical protein.
Residues 1-366 are 24% similar to CT392.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
112
transmembrane  
282  
299
non-globular  
315  
385

PDB Hit:


Gene Protein Sequence:
MSSVNQSSGTPNPEEVTSPESTEENKNVVSSDEAQATHAVALPIVTQLSL
PEGVGTSSEETASNPRVDEIVAEVSSSRAVADQISSLVERVGELLDDLKG
AQSLFTSFQSELKNCLPAWKSSTRRLETRGAGDNADIARLELFRSDYEAV
LGHANQFHGKAHLILSKLTDVHHKLQGLSREDLSLAFDNNDRVLEHLGSL
GLDVDAEGNWSLSCERGIPRLVLTADSMLVQIKKVNLPTVEELRTLQGTT
ESSSDPRVEESLSCCERLLNELRRLWANFVGFISSCYDNIVFVLMWIVRR
INLLPGLGCLPFHNPDASQEDQRSSSGERSTRRERLSRRSDLSEEEMIVR
AEGESIHPESPHGDGRNQPSRGDKQDSDSEEETEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGTCAGTAAATCAAAGCTCTGGAACCCCGAATCCAGAAGAGGTAAC
TTCTCCTGAATCTACGGAAGAAAACAAAAATGTTGTTTCTTCAGATGAGG
CGCAAGCCACGCATGCTGTGGCTCTTCCTATAGTCACTCAACTTTCTCTT
CCTGAAGGTGTGGGGACCTCATCTGAAGAAACGGCGAGTAATCCGAGGGT
AGACGAGATTGTAGCTGAAGTTTCTTCGAGTCGGGCGGTTGCTGATCAGA
TCTCATCACTTGTAGAGCGTGTTGGAGAGCTTTTAGACGACCTTAAGGGT
GCCCAGTCCCTTTTCACTAGCTTTCAGTCAGAGTTGAAAAACTGTCTTCC
GGCATGGAAATCTTCAACGAGAAGACTCGAAACTCGAGGTGCTGGGGATA
ATGCGGATATAGCGAGGCTGGAATTATTTCGTAGCGATTACGAGGCTGTC
TTAGGCCATGCGAACCAGTTTCATGGGAAGGCTCATCTCATTTTAAGTAA
GTTAACAGATGTACATCACAAGCTACAGGGACTCAGTCGTGAAGATCTTT
CCCTGGCGTTTGACAATAATGATAGGGTTCTTGAGCATCTGGGTTCGTTA
GGGCTTGATGTAGACGCTGAAGGTAATTGGTCTCTTTCTTGTGAGAGGGG
GATTCCGCGACTGGTGCTTACTGCTGACAGTATGCTTGTCCAGATCAAGA
AAGTGAATCTACCTACTGTAGAAGAATTGCGGACTCTTCAGGGAACAACG
GAATCTTCGTCTGATCCTAGGGTTGAAGAAAGTTTGTCTTGCTGTGAAAG
ATTGCTCAATGAATTACGTCGTCTTTGGGCGAATTTTGTAGGTTTTATTT
CGAGTTGCTATGACAACATCGTGTTTGTTTTGATGTGGATAGTGAGACGG
ATTAACCTTTTGCCTGGGCTGGGGTGTTTGCCTTTCCATAATCCCGATGC
TTCTCAAGAAGACCAGAGGTCTTCTTCCGGAGAGCGTTCTACAAGGAGAG
AACGCCTTTCTCGGCGATCTGACTTATCTGAGGAAGAGATGATTGTGAGA
GCTGAGGGAGAGTCTATACATCCTGAATCTCCCCATGGAGATGGCCGTAA
CCAACCTAGTCGAGGTGATAAGCAAGACTCTGATAGTGAGGAAGAGACGG
AGTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy