Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR392 IGR398 IGR393 IGR396 IGR394 IGR397 IGR391 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0494 CPn0498 CPn0491 CPn0499 CPn0497 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0498

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
579035

Gene Stop:
578082

Gene Length:
954

Molecular Weight*:
36191

pI*:
6.60

Net Charge*:
-1.30

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
29

PDB Hit:


Gene Protein Sequence:
MNRRKARWVVALFAMTALISVGCCPWSQAKSRCSIDKYIPVVNRLLEVCG
LPEAENVEDLIESSSAWVLTPEERFSGELVSICQVKDEHAFYNDLSLLHM
TQAVPSYSATYDCAVVFGGPLPALRQRLDFLVREWQRGVRFKKIVFLCGE
RGRYQSIEEQEHFFDSRYNPFPTEENWESGNRVTPSSEEEIAKFVWMQML
LPRAWRDSTSGVRVTFLLAKPEENRVVANRKDTLLLFRSYQEAFPGRVLF
VSSQPFIGLDACRVGQFFKGESYDLAGPGFAQGVLKYHWAPRICLHTLAE
WLKETNGCLNISEGCFG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGAAGAAAAGCAAGATGGGTAGTGGCATTGTTCGCAATGACGGC
GCTCATTTCTGTTGGGTGTTGTCCTTGGTCACAAGCGAAATCAAGATGTT
CTATTGATAAGTATATTCCTGTAGTCAATCGTTTACTAGAAGTTTGTGGA
CTTCCTGAAGCTGAGAATGTTGAGGATTTAATCGAGTCCTCGTCTGCTTG
GGTACTGACTCCTGAAGAACGTTTTTCTGGAGAGTTAGTCTCTATCTGTC
AGGTTAAAGATGAGCATGCTTTCTATAACGATTTGTCTTTATTACATATG
ACTCAGGCTGTGCCTTCGTATTCTGCAACGTATGATTGTGCTGTAGTTTT
TGGCGGGCCTTTGCCAGCGCTACGTCAGCGCTTAGATTTTTTGGTGCGAG
AGTGGCAGCGTGGCGTGCGCTTTAAGAAAATCGTTTTTCTATGTGGAGAG
CGAGGGCGCTATCAGTCTATTGAAGAACAAGAGCATTTCTTTGATTCTCG
GTACAATCCTTTCCCTACTGAAGAGAACTGGGAATCTGGTAACCGAGTTA
CTCCCTCTTCTGAAGAAGAGATTGCCAAATTTGTTTGGATGCAAATGCTT
TTACCTAGAGCATGGCGAGATAGTACTTCAGGAGTCAGAGTGACATTTCT
TCTAGCAAAGCCAGAGGAAAATCGTGTGGTTGCGAATCGTAAGGACACCT
TACTTTTATTCCGTTCTTATCAAGAAGCGTTTCCGGGACGCGTGTTATTT
GTAAGTAGTCAACCCTTTATCGGTTTAGATGCTTGCAGGGTCGGGCAGTT
TTTCAAAGGGGAAAGCTATGATCTTGCTGGACCTGGATTTGCTCAAGGAG
TCTTGAAGTATCATTGGGCTCCAAGGATTTGTCTACATACTTTAGCGGAA
TGGTTAAAGGAAACGAACGGCTGCTTAAATATTTCAGAGGGTTGTTTTGG
ATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy