Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR392 IGR398 IGR393 IGR396 IGR394 IGR397 IGR391 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0490 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0490 CPn0494 CPn0498 CPn0491 CPn0499 CPn0497 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 hrcA, - CPn0501 proS, - CPn0500 CPn0490 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0497

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
578089

Gene Stop:
577817

Gene Length:
273

Molecular Weight*:
9959

pI*:
10.30

Net Charge*:
4.23

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0497 is weakly similar to hypothetical proteins in Bartonella bacilliformis (AE001312), in E. coli (YggU_Ecoli) and in Richettsia prowazekii (AJ235273).

CPn0497 is orthologously related to CT388, a predicted conserved hypothetical protein.
Residues 1-80 are 62% similar to CT388.

No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1872
COG name: Uncharacterized ACR, YggU family
Functional Class:  S
The phylogenetic pattern of COG1872 is amt-----e---------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 77 (E-value = 1.8e-39) place CPn0497 in the DUF167 family which is described as Uncharacterized ACR, YggU family COG1872 (PF02594)

PDB Hit:


Gene Protein Sequence:
LDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLA
KALSLPKRDVTLIAGETSRKKKFLLPNRVQDIIFSLHIDV$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGATGATTCATGGATCTTAGAGGTTAAAGTCACTCCAAAAGCCAAAGA
GAACAAAATTGTAGGCTTTGATGGACAAGCTTTGAAGGTCCGTGTTACCG
AACCCCCAGAAAAGGGTAAGGCCAATGATGCTGTAATTTCTTTATTAGCA
AAAGCTTTATCCTTACCGAAGCGTGATGTCACTTTAATTGCAGGAGAAAC
TTCTCGAAAGAAAAAGTTTCTTCTTCCTAACAGAGTTCAAGACATTATTT
TTTCTTTGCATATAGACGTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy