Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR392 IGR393 IGR396 IGR394 IGR397 IGR391 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0494 CPn0498 CPn0491 CPn0499 CPn0497 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0496

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
576793

Gene Stop:
577815

Gene Length:
1023

Molecular Weight*:
37991

pI*:
9.20

Net Charge*:
9.84

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0496 is orthologously related to CT391, a hypothetical protein: residues 3-325 are 54% similar to CT391.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 37 to 324 (E-value = 9.8e-151) place CPn0496 in the DUF534 family which is described as Protein of unknown function (DUF534) (PF04392)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24

PDB Hit:


Gene Protein Sequence:
MTILRKLSQYLFFFSLFCSFIYVATCGSQPDSVSSPKIAIFLSFPHPLLE
DCSKSCIETLKDFENLPEIVVLNAEDSIVKARKIARSLHTDKNVVAIVTL
GTIATKVMSHIETQKPVIYAAVPDRESLTLPKNTMNIYGVNDTLDINQYC
FAIQAVATNAQSIVYLKPSEPFPSDLQKEIVKKLHASGIEVIEISITSST
FKTRIRQAIDKRPSAIFIPLSPLSHKEGTAFLQEILKEKIPIITDDTSLI
SEGACIACSVDYKKSGKQIAKIVHHLLYNNHDVDSLRKIIAQRLSPTTTF
NEDIIKYLGIKLHKTERNQFLSFKSKKLEKSEKGKNVAVS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATTCTACGTAAACTCTCTCAGTACTTATTTTTCTTTTCTCTGTT
TTGCTCTTTCATCTATGTAGCCACTTGTGGTTCTCAACCAGATAGCGTCT
CCTCTCCTAAAATCGCAATTTTCTTATCCTTTCCCCATCCCCTATTAGAA
GATTGCAGTAAAAGCTGTATAGAAACCTTGAAAGATTTTGAGAACCTTCC
TGAAATTGTTGTCCTAAATGCTGAAGACAGTATCGTAAAGGCTAGGAAAA
TTGCTCGCTCCTTACATACCGATAAAAATGTCGTGGCGATTGTCACCTTA
GGAACTATTGCTACGAAGGTCATGAGCCACATTGAAACACAGAAACCTGT
GATCTATGCCGCTGTTCCTGATCGCGAAAGCCTAACCCTTCCTAAAAACA
CAATGAATATCTACGGAGTGAATGACACTCTAGACATCAATCAATACTGC
TTTGCTATACAAGCCGTAGCTACCAATGCACAATCTATCGTGTATTTAAA
ACCCTCCGAACCTTTCCCCTCAGATCTCCAAAAAGAAATTGTTAAGAAAC
TCCATGCTTCAGGAATTGAGGTCATTGAGATCTCTATTACAAGCAGTACA
TTCAAAACCCGGATACGCCAGGCTATCGACAAGCGCCCCTCAGCTATCTT
CATTCCCCTCTCCCCACTTTCTCATAAAGAAGGCACCGCATTCCTTCAGG
AAATCCTCAAAGAGAAAATCCCTATCATTACCGACGATACCTCCTTAATT
TCCGAAGGAGCCTGCATTGCCTGTAGCGTGGATTACAAAAAATCAGGAAA
ACAAATCGCAAAAATTGTGCACCACCTACTCTATAACAATCACGATGTGG
ACAGCCTGCGTAAAATCATTGCTCAACGCCTGTCACCTACAACCACCTTT
AATGAAGATATCATCAAGTACTTAGGAATCAAGCTTCATAAAACAGAACG
CAACCAGTTCTTATCTTTTAAAAGCAAAAAATTGGAAAAATCTGAGAAAG
GGAAAAACGTAGCTGTGAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy