Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR392 IGR393 IGR396 IGR394 IGR397 IGR391 IGR390 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0493 CPn0494 CPn0498 CPn0491 CPn0499 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0494 CPn0498 CPn0491 CPn0499 CPn0497 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 proS, - CPn0500 CPn0490 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0495

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspC  

Definition:
aspartate aminotransferase

Gene Start:
575603

Gene Stop:
576796

Gene Length:
1194

Molecular Weight*:
44478

pI*:
5.50

Net Charge*:
-7.48

EC:
2.6.1.1  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Amino Acid Metabolism; Arginine and prolinemetabolism Amino Acid Metabolism; Phenylalanine, tyrosineand tryptophan biosynthesis Energy Metabolism; Carbon fixation Defline:

Comment:
The aspartate aminotransferase catalyzes the
interconversion of aspartate and glutamate. In
other bacteria, it is a homodimer.

Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CPn0495 is orthologously related to CT390, a predicted aspC aspartate aminotransferase.
Residues 1-385 are 56% similar to CT390.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0436
COG name: PLP-dependent aminotransferases
Functional Class: E
The phylogenetic pattern of COG0436 is AMTKYQVCEBRhUJ---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 79 to 389 (E-value = 1.8e-09) place CPn0495 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

PDB Hit:


Gene Protein Sequence:
MRRNPHFSLLKPQYLFSEISKKLAQFRKENPEISVIDLSIGDTTQPLCRS
ITQAIKEFCVSQEKQETYRGYGPETGLEKLRTKIASEVYENRISPEEIFI
SDGAKPDIFRLFSFFGSEKTLGLQDPVYPAYRDIAHITGIRDIIPLACRK
ETGFIPELPNQQSLDILCLCYPNNPTGTVLTFQQLQALVNYANQHGTVLI
FDAAYSAFVSDPSLPKSIFEIPEAKYCAIEINSFSKSLGFTGMRLAWNVI
PKELTYDNNEPMINDWKRLFATTFNGASLLMQEAGYYGLDLFPTPPAISL
YLTNAQKLKKSLETAGFSVHGGDHAPYLWVELPEGISDEEAFDFFLHQYH
IAVTPGHGFGSCGQGFVRFSALTQPQNIALACDRLCTASLKETMVLA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTAGAAATCCCCACTTTTCTCTTCTCAAGCCTCAGTATCTATTTTC
TGAAATTAGTAAAAAGCTTGCTCAGTTTCGCAAGGAGAATCCAGAAATCT
CTGTCATAGATCTTTCTATCGGAGATACGACACAACCTCTCTGCCGCTCT
ATTACTCAGGCAATCAAAGAGTTCTGCGTTTCTCAAGAGAAACAAGAGAC
CTATCGTGGGTACGGCCCAGAAACCGGATTAGAAAAATTACGCACAAAAA
TTGCCTCTGAAGTCTATGAAAATAGAATCTCCCCTGAAGAGATTTTTATT
TCGGATGGTGCCAAACCTGATATCTTCCGTCTCTTTTCTTTTTTTGGCTC
AGAAAAGACTCTAGGTCTACAGGATCCTGTCTATCCAGCTTATAGAGACA
TTGCCCACATTACAGGAATCCGCGACATTATCCCCCTAGCATGCAGAAAA
GAAACTGGGTTTATTCCAGAACTTCCGAACCAACAATCCCTAGACATTCT
TTGTCTATGCTATCCTAACAACCCCACAGGAACAGTTCTAACCTTTCAAC
AACTCCAAGCACTTGTGAACTACGCGAATCAGCACGGAACCGTTCTTATT
TTTGATGCGGCCTATAGCGCCTTTGTCTCAGATCCTAGCCTACCTAAAAG
CATCTTCGAAATCCCTGAAGCAAAATATTGTGCTATAGAAATCAACTCTT
TCTCTAAATCATTAGGCTTTACTGGCATGCGCCTTGCCTGGAACGTGATC
CCTAAAGAACTCACCTATGACAATAACGAACCTATGATCAACGATTGGAA
ACGGCTCTTTGCGACTACATTTAACGGAGCATCTCTCCTCATGCAAGAAG
CAGGGTATTACGGCCTAGATTTATTTCCGACACCTCCCGCCATCTCTTTA
TATCTAACCAATGCTCAGAAACTTAAAAAAAGCTTAGAAACTGCAGGATT
CTCAGTTCATGGTGGCGATCATGCCCCTTACCTTTGGGTAGAACTCCCTG
AAGGAATCTCTGATGAAGAAGCGTTTGATTTCTTCTTACATCAGTATCAT
ATTGCAGTGACTCCCGGCCACGGTTTTGGTTCCTGTGGACAAGGATTTGT
TCGTTTCTCCGCTCTGACACAACCACAAAATATCGCTTTAGCCTGTGACC
GCCTCTGTACCGCTTCACTAAAAGAAACGATGGTTCTTGCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy