Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR389 IGR392 IGR393 IGR396 IGR394 IGR391 IGR390 CPn0493 CPn0494 CPn0489 CPn0498 CPn0491 CPn0499 CPn0487 CPn0492 aspC, - CPn0495 CPn0490 CPn0493 CPn0494 CPn0489 CPn0498 CPn0491 CPn0499 CPn0487 CPn0492 aspC, - CPn0495 CPn0490 CPn0494 CPn0498 CPn0491 CPn0499 CPn0497 hitA,ycfH, - CPn0488 CPn0487 CPn0497 CPn0493 hitA,ycfH, - CPn0488 CPn0489 CPn0492 aspC, - CPn0495 CPn0490 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0492

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
574652

Gene Stop:
574807

Gene Length:
156

Molecular Weight*:
6118

pI*:
8.10

Net Charge*:
1.61

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LIFPICEERNSQQTYKHLHVESACFLLESPLKIHWSSPYGFPPFYRRDLK
L$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATCTTTCCGATCTGTGAAGAGAGGAATTCACAACAGACCTACAAACA
TCTCCATGTAGAATCAGCTTGTTTCCTTCTAGAATCTCCGTTGAAAATCC
ACTGGTCTTCTCCTTATGGATTCCCTCCCTTCTACCGCAGAGACCTAAAA
CTCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy