Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR395 IGR389 IGR392 IGR393 IGR394 IGR391 IGR390 CPn0493 CPn0494 CPn0489 CPn0498 CPn0491 CPn0487 CPn0492 aspC, - CPn0495 CPn0490 CPn0493 CPn0494 CPn0489 CPn0498 CPn0491 CPn0487 CPn0492 aspC, - CPn0495 CPn0490 CPn0494 CPn0489 CPn0498 CPn0491 CPn0487 CPn0497 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0497 CPn0493 CPn0492 aspC, - CPn0495 CPn0490 CPn0496 CPn0496
* Calculated from Protein Sequence

Gene ID: CPn0491

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
574352

Gene Stop:
573333

Gene Length:
1020

Molecular Weight*:
39113

pI*:
6.40

Net Charge*:
-3.29

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0491 is orthologously related to CT389, a predicted hypothetical protein.
Residues 1-339 are 68% similar to CT389.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 339 (E-value = 6.7e-293) place CPn0491 in the DUF1207 family which is described as Protein of unknown function (DUF1207) (PF06727)

PDB Hit:


Gene Protein Sequence:
MHFLDSRTQVVIEKNRAYLFSLPVDSSLSEAITNFVRDLPFICAVEICER
PYGECITRSSAERPLLPKEKTLGMPIFCGKEGVWLPQNTILFSPLIADPR
QVTNSAGIRFNEKVVGNRVGATIFGGDFILLRLFDVSRFHVDCDFGIQGG
VFSVFDLDHPESCMVNSDFFVAGLWSGAIDKWSFRFRLWHLSSHLGDEFI
LTHPNFPRFNLSDEGVDLFISFRYTPQIRLYGGCGYIVSRDLTFPERPFY
CEWGAELRPFGLREGNLHAQPIFAMHFRCWEEQKFGLDQSYILGMEWAKF
QEIGRKIRAVLEYHQGFSKEGQFIREPCNYYGFRLTYGF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTTTTTAGATAGCCGTACGCAAGTTGTTATTGAGAAGAATAGAGC
GTATCTTTTCTCTTTGCCTGTAGATTCGAGTTTATCAGAAGCCATTACCA
ACTTTGTTAGGGATCTTCCCTTCATATGTGCTGTGGAGATTTGCGAGCGT
CCTTATGGTGAATGCATAACGAGATCTTCTGCGGAGCGTCCCTTACTCCC
TAAAGAGAAAACTTTAGGAATGCCAATTTTCTGCGGCAAAGAAGGGGTAT
GGTTACCTCAAAATACCATTTTGTTTTCTCCTTTGATTGCAGATCCTCGT
CAGGTTACCAACAGTGCTGGCATTCGTTTTAATGAGAAGGTCGTGGGGAA
TCGGGTAGGTGCTACCATCTTTGGGGGAGATTTTATTCTCCTGCGTCTTT
TTGATGTTTCTCGATTCCATGTAGATTGTGATTTCGGAATTCAAGGAGGA
GTCTTCTCAGTTTTTGATTTAGATCATCCTGAATCGTGCATGGTAAATTC
AGATTTCTTTGTTGCCGGACTCTGGTCAGGGGCTATAGATAAATGGAGTT
TTAGGTTTCGATTGTGGCACCTCTCGTCCCATTTAGGAGATGAGTTTATT
CTTACGCATCCAAATTTCCCAAGATTTAATTTGAGTGATGAGGGCGTCGA
TCTCTTCATTTCGTTTCGTTACACACCACAGATCCGCTTGTATGGCGGCT
GCGGTTATATTGTAAGTAGGGATCTTACTTTTCCTGAGCGGCCGTTTTAC
TGTGAATGGGGTGCGGAACTCAGACCTTTTGGTCTGAGAGAAGGAAATCT
CCACGCACAACCGATTTTCGCGATGCATTTCCGTTGTTGGGAAGAACAGA
AATTTGGCTTGGATCAAAGCTATATTTTAGGCATGGAGTGGGCCAAATTT
CAAGAAATCGGAAGGAAAATCCGTGCTGTTTTAGAATATCATCAGGGATT
TTCTAAAGAAGGCCAATTCATTCGTGAACCGTGTAATTACTACGGTTTCC
GTCTTACCTATGGATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy