Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR389 IGR392 IGR393 IGR387 IGR386 IGR394 IGR391 IGR390 IGR388 CPn0493 CPn0494 CPn0489 CPn0491 CPn0486 CPn0487 CPn0492 CPn0485 aroG, - CPn0484 CPn0490 CPn0493 CPn0494 CPn0489 CPn0491 CPn0486 CPn0487 CPn0492 CPn0485 aroG, - CPn0484 CPn0490 CPn0494 CPn0489 CPn0491 CPn0486 CPn0487 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0493 CPn0492 aroG, - CPn0484 CPn0490 CPn0485
* Calculated from Protein Sequence

Gene ID: CPn0489

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
570965

Gene Stop:
570093

Gene Length:
873

Molecular Weight*:
33460

pI*:
5.50

Net Charge*:
-9.19

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0489 is similar to two hypothetical proteins in yeast: Yk206h5.3 and Yer156c (Yey6).

CPn0489 is orthologously related to CT386, a hypothetical protein: residues 1-290 are 73% similar to CT386.

No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 285 (E-value = 8.2e-196) place CPn0489 in the UPF0160 family which is described as Uncharacterised protein family (UPF0160) (PF03690)

PDB Hit:


Gene Protein Sequence:
MQIPRSIGTHDGSFHADEVTACALLIIFDLVDENKIIRSRDPVVLSKCEY
VCDVGGVYSIENKRFDHHQVSYDGSWSSAGMILHYLKEFGYMDCEEYHFL
NNTLVHGVDEQDNGRFFSKEGFCSFSDIIKIYNPREEEETNSDADFSCAL
HFTIDFLCRLRKKFQYDRVCRGIVREAMETEDMCLYFDRPLAWQENFFFL
GGEKHPAAFVCFPSCDQWILRGIPPNLDRRMDVRVPFPENWAGLLGKELS
KVSGIPGAVFCHKGLFLSVWTNRESCQRALRLTLQDRGII$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGATTCCAAGAAGCATTGGTACTCACGATGGTTCTTTCCATGCGGA
TGAGGTCACAGCGTGTGCTCTCCTTATTATTTTCGATCTTGTGGATGAAA
ATAAAATTATACGCTCTCGAGATCCTGTCGTATTATCGAAATGTGAATAT
GTTTGTGATGTCGGTGGTGTTTATTCTATAGAAAACAAGCGTTTTGATCA
TCATCAAGTCTCTTATGATGGATCTTGGAGTAGTGCAGGTATGATTCTGC
ATTATCTTAAAGAGTTTGGTTATATGGATTGTGAAGAATATCATTTCCTT
AACAACACTTTGGTACATGGTGTGGATGAACAAGATAATGGCAGATTCTT
CTCTAAGGAGGGATTTTGTTCGTTTTCTGATATTATTAAAATTTATAATC
CTCGCGAGGAAGAAGAAACTAATTCGGATGCGGATTTTTCTTGTGCTTTG
CATTTTACCATCGACTTTTTGTGTCGGCTAAGGAAGAAGTTTCAGTATGA
TCGAGTTTGTAGGGGGATTGTCAGAGAAGCCATGGAAACCGAGGATATGT
GTTTATATTTTGATCGTCCTTTAGCATGGCAAGAAAATTTCTTTTTTTTA
GGGGGAGAGAAGCACCCTGCAGCTTTTGTTTGTTTTCCTTCCTGCGATCA
ATGGATTTTACGAGGGATTCCTCCGAATTTAGATCGCCGTATGGACGTTC
GTGTTCCTTTCCCTGAGAATTGGGCAGGTTTGTTAGGTAAAGAGTTGTCC
AAAGTATCAGGGATTCCTGGGGCTGTGTTCTGCCATAAAGGTCTTTTCCT
TTCTGTATGGACAAATAGAGAAAGTTGCCAACGTGCTTTGCGGTTAACGT
TACAAGATCGAGGGATCATATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy