Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR389 IGR392 IGR387 IGR386 IGR391 IGR390 IGR388 CPn0493 CPn0489 CPn0491 CPn0486 CPn0487 CPn0492 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0493 CPn0489 CPn0491 CPn0486 CPn0487 CPn0492 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0493 CPn0489 CPn0491 CPn0486 CPn0487 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0492 CPn0485 CPn0490 CPn0483 aroG, - CPn0484
* Calculated from Protein Sequence

Gene ID: CPn0488

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hitA  ycfH  

Definition:
protein kinase C inhibitor (HIT family protein)

Gene Start:
570096

Gene Stop:
569764

Gene Length:
333

Molecular Weight*:
12055

pI*:
5.60

Net Charge*:
-3.10

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
In eukaryotes, HINT (histidine triad nucleotide binding proteins)
are protein kinase C inhibitors. In bacteria, the function of
HIT-like proteins is not known (but does seem to inhibit protein kinase C).

Blast Summary:  PSI-Blast Search
CPn0488 is orthologously related to CT385: residues 2-110 of CPn0488 are 69% similar to residues 3-111 of CT385, a predicted protein kinase C inhibitor (HIT family protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0537
COG name: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases
Functional Class:  F,G,R
The phylogenetic pattern of COG0537 is amTKYQ-cebRhUJgpo-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 106 (E-value = 2.3e-39) place CPn0488 in the HIT family which is described as HIT domain (PF01230)

PDB Hit:


Gene Protein Sequence:
MTVFKQIIDGLIDCEKVFENENFIAIKDRFPQAPVHLLIIPKKPIPRFQD
IPGDEMILMAEAGKIVQELAAEFGIADGYRVVINNGAEGGQAVFHLHIHL
LGGRPLGAIA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGTATTCAAACAAATTATCGATGGATTGATAGATTGTGAAAAGGT
ATTTGAAAACGAAAATTTCATAGCTATAAAAGATCGTTTTCCTCAAGCTC
CTGTTCATCTTCTTATCATTCCTAAAAAACCTATACCACGATTTCAGGAT
ATCCCAGGGGATGAGATGATTTTAATGGCAGAGGCTGGAAAGATCGTGCA
AGAGCTTGCTGCAGAATTTGGAATTGCCGATGGGTATCGTGTGGTTATCA
ACAACGGTGCTGAAGGAGGACAGGCGGTATTTCACTTACATATTCATCTT
TTAGGTGGGCGTCCTTTAGGTGCTATAGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy