Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR389 IGR387 IGR386 IGR390 IGR388 CPn0489 CPn0491 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0489 CPn0491 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0489 CPn0491 CPn0486 CPn0487 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0485 aroG, - CPn0484 CPn0490 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0487

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
569740

Gene Stop:
568109

Gene Length:
1632

Molecular Weight*:
60653

pI*:
5.20

Net Charge*:
-14.62

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0487 is orthologously related to CT384, a predicted hypothetical protein. Residues 3-543 are 44% similar to CT384.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1413
COG name: Phycocyanin alpha-subunit phycocyanobilin lyase and related proteins, CpcE/NblB family
Functional Class:  F
The phylogenetic pattern of COG1413 is --T-y--Ceb------olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
288  
373

PDB Hit:


Gene Protein Sequence:
LFGSESLRYQLLIQDFAKVSEEGIGLLESKEYSLLQAKLVLRALAQNSSF
DDWFRSFKKCQISYPELAHDRDVLEEFGIQVLREGIENPSVTVRAVSVLA
IGLARDFRLVPLLLQSCNDDSAIVRSLALQVAVNYGSESLKKAIVELARN
DDSIHVRITAYQVVALLQIEELLPFLRERAENKLVDSVERREAWKACLEL
SSQFLETGVAKDDIDQALFTCEVLRNGMLPETTEIFTELLSVEHPEVQES
LLLSALAWSHQLQNHKEFLSKVRHVMCTSPFAKVRFQAAALLHLHGDPLG
RDSLVEGLRSPQPLVCEAASAALCSLGIHGVPLAKEHLESLSSRKAAANL
SILLLVSREDIERAGDVIARYLSNPEMCWAIEYFLWDAQWNLRGDTFPLY
SDMIKREIGRKLIRLLAVARYSQAKAVTATFLSGQQAQGWSFFSGMFWEE
GDVKTSEDLVTDACFAAKLEGALASLCQKKDQASLQRVSQLYNDSRWQDK
LAILESVAFSENLDAVPFLLDCCHHEAPSLRSAAAGALFSIFK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTCGGCTCGGAGTCCCTCCGTTATCAATTGTTGATCCAAGATTTTGC
AAAAGTTTCAGAAGAGGGCATAGGCCTTTTGGAGTCTAAAGAGTATTCTT
TACTTCAGGCTAAGCTAGTTTTAAGGGCTCTGGCTCAAAATTCTTCTTTT
GATGATTGGTTTAGAAGTTTTAAGAAGTGTCAGATTTCCTATCCAGAGTT
AGCTCATGATCGCGATGTCTTAGAAGAATTTGGGATTCAAGTTCTGCGTG
AGGGAATCGAAAATCCTTCCGTGACCGTTCGTGCTGTGAGTGTCCTTGCT
ATTGGGCTTGCTAGAGATTTTCGCTTGGTCCCTCTCCTGCTCCAAAGTTG
TAATGATGACAGTGCTATTGTTCGATCTTTGGCTCTTCAGGTTGCTGTGA
ACTATGGCTCTGAAAGTTTAAAAAAGGCCATTGTAGAGCTTGCCCGTAAT
GATGATTCTATTCATGTTCGGATTACAGCATATCAGGTGGTCGCTCTTTT
ACAGATAGAGGAGCTATTGCCATTTTTAAGAGAGCGTGCTGAGAACAAAC
TTGTAGATAGTGTAGAACGTCGAGAGGCGTGGAAGGCTTGCTTGGAACTC
TCTTCTCAATTTCTAGAGACGGGTGTAGCTAAGGACGATATTGATCAAGC
GTTGTTCACTTGTGAAGTGTTGCGTAACGGTATGTTGCCAGAGACTACTG
AGATTTTTACAGAACTCTTATCTGTAGAGCATCCTGAAGTGCAGGAGTCT
CTCTTACTTTCTGCTTTAGCTTGGAGTCATCAGCTACAGAATCACAAAGA
GTTTCTTAGTAAAGTGCGCCATGTGATGTGCACTTCTCCATTTGCAAAAG
TACGTTTTCAAGCTGCTGCACTTCTCCATCTGCATGGAGACCCTTTGGGC
AGAGACTCTCTGGTTGAGGGCTTGCGCTCTCCTCAACCTCTTGTGTGTGA
GGCAGCTTCGGCGGCTCTCTGCTCTTTAGGAATCCATGGAGTCCCTTTGG
CAAAGGAGCATTTGGAGAGCCTTTCTTCTCGAAAGGCTGCTGCGAACCTC
TCCATTTTGCTTCTTGTGAGCCGTGAAGATATTGAAAGAGCTGGAGATGT
GATTGCTCGCTACCTCTCCAATCCTGAAATGTGCTGGGCTATAGAGTATT
TCTTATGGGATGCACAATGGAATTTACGTGGTGATACCTTCCCTCTATAT
TCGGATATGATTAAACGTGAGATTGGTAGGAAGCTCATTCGCCTTTTGGC
AGTAGCTCGCTATAGCCAAGCCAAGGCTGTAACAGCAACGTTCCTTTCAG
GACAGCAAGCTCAGGGATGGAGCTTTTTTTCTGGAATGTTCTGGGAAGAG
GGAGATGTGAAAACTTCTGAGGATTTGGTTACAGATGCTTGCTTTGCAGC
AAAGTTGGAAGGAGCGTTAGCCTCGCTATGTCAGAAAAAAGATCAAGCTT
CCCTACAGAGGGTCTCTCAACTTTATAATGACAGCCGTTGGCAAGATAAA
TTAGCAATCTTAGAGAGCGTTGCTTTTTCTGAGAATCTTGATGCTGTGCC
TTTTCTTCTAGACTGCTGCCATCACGAAGCTCCTTCGCTGCGAAGTGCAG
CAGCGGGTGCTCTTTTCTCTATTTTCAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy