Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR389 IGR387 IGR386 IGR390 IGR388 CPn0489 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0489 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0490 CPn0483 CPn0489 CPn0486 CPn0487 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0485 aroG, - CPn0484 CPn0490 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0486

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
sodium:solute symporter family

Gene Start:
567784

Gene Stop:
566402

Gene Length:
1383

Molecular Weight*:
49346

pI*:
9.90

Net Charge*:
13.76

EC:
 

Functional Class:
transport and binding proteins; unknown substrate  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to permease (mainly proline) and symporter (sodium/pantothenate) sequences; e.g. residues 17-206 are 27% similar to (AP000006) 537aa long hypothetical proline permease [Pyrococcus horikoshii]; residues 25-211 are 28% similar to PANF_ECOLI, a sodium/pantothenate symporter; residues 50-263 are 25% similar to PANF_HAEIN; and residues 21-202 are 25% similar to (D78137) Na+/glucose symporter [Vibrio parahaemolyticus].

BLAST reveals no significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0591
COG name: Na+/proline, Na+/panthothenate symporters and related permeases
Functional Class: E,H,R
The phylogenetic pattern of COG0591 is A-tKyq-cEB-Huj--o--nX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 27-399 span four regions of similarity to blocks BL00456A,C (Sodium:solute symporter family proteins.)

ProDom Summary:  Protein Domain Search
Residues 21-125 are 30% similar to a defined domain of O02228_CAEEL, a hypothetical protein sequence.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 50 to 414 (E-value = 3e-07) place CPn0486 in the SSF family which is described as Sodium:solute symporter family (PF00474)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
32
transmembrane  
59  
76
transmembrane  
87  
104
transmembrane  
115  
132
transmembrane  
139  
157
transmembrane  
164  
181
transmembrane  
195  
213
transmembrane  
230  
247
transmembrane  
269  
287
transmembrane  
302  
326
transmembrane  
354  
377
transmembrane  
403  
420
transmembrane  
425  
447

PDB Hit:


Gene Protein Sequence:
LLKGNIFHLGCGVLYFMNFSLFLFFLIAIQGICLYVGRRGSKKVEDRESY
FLAGRSLKIFPLMMTFIATQIGGGVLLGAAEEAFCYGYGGILYPLGVALG
LIFLGMGPGKRLAEGSLTTVVSIFEVFYGSKKLRKIAFLLSAGSLFFILV
AQVIALDRLFSSFPFGKYVTVAFWIVLASYTSTGGFRGVVRTDVIQAGFL
LIAVLVCGVSVWLSVPKSLSVLDPFQSLPCAKLSNWIFMPMLFMLVEQDM
VQRCVAASSPKRLQWAAVGAGLVLLLFNFIPLFLGSLGAKAGLKAGCPLI
DTIAYFCNPSLAAVMAAAIGVAILSTADSLMNAVSQLIAEEYPTLKAPYY
RYLVLGLAVAAPLVAIGFTNIVDVLILSYSLSVCCLSVPVGFYLLAPKGR
RVSGAAAWAGVLVGALGYGWVQIVSLGMFGELLAWVGSLVAFSFVGFIEI
TWKNKVKTQT$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTTAAAGGAAATATTTTTCATTTAGGTTGTGGAGTTCTTTATTTTAT
GAATTTTTCATTATTTTTATTTTTCCTGATAGCTATTCAGGGAATCTGCT
TGTACGTGGGACGTCGTGGTAGCAAAAAGGTAGAAGATCGCGAGAGCTAT
TTTCTTGCAGGAAGGAGTTTAAAAATCTTTCCTTTGATGATGACATTCAT
TGCCACCCAAATCGGTGGCGGTGTACTTCTTGGGGCTGCTGAAGAGGCCT
TCTGTTATGGTTATGGGGGGATTCTTTATCCTTTAGGAGTCGCTTTAGGG
TTGATTTTCTTAGGAATGGGGCCCGGGAAGCGGTTGGCAGAGGGATCGTT
AACGACCGTAGTCTCTATCTTTGAAGTGTTTTATGGTTCTAAAAAGCTCC
GTAAGATCGCATTTTTATTATCCGCAGGTTCCTTATTTTTCATCCTGGTC
GCTCAGGTGATTGCTTTAGATCGGTTGTTTAGCAGCTTCCCTTTTGGCAA
GTACGTAACCGTAGCATTTTGGATTGTCTTAGCATCCTATACCTCAACAG
GAGGGTTTCGCGGGGTCGTACGTACTGATGTGATCCAAGCAGGATTTCTT
CTTATTGCGGTGCTCGTCTGTGGTGTTTCTGTATGGCTCTCTGTCCCTAA
ATCCTTGTCTGTGTTGGATCCTTTCCAATCACTTCCTTGTGCGAAGCTTT
CCAATTGGATATTCATGCCTATGCTCTTTATGCTTGTTGAGCAGGATATG
GTGCAAAGGTGTGTGGCTGCCTCCTCTCCAAAACGCTTGCAATGGGCGGC
TGTAGGCGCAGGCCTTGTTCTTCTTCTTTTTAACTTTATCCCTTTATTTT
TAGGTTCTTTAGGAGCTAAAGCAGGCCTTAAAGCAGGATGCCCTCTGATT
GATACCATTGCATATTTTTGCAATCCCTCACTAGCAGCTGTGATGGCTGC
TGCCATCGGCGTTGCGATTCTCTCTACCGCGGACTCTCTTATGAATGCTG
TAAGCCAGCTAATCGCTGAAGAATACCCTACGTTGAAAGCCCCTTATTAT
CGTTATTTAGTATTGGGTTTGGCGGTTGCAGCTCCTCTTGTTGCTATTGG
TTTTACAAACATCGTAGATGTCTTGATTTTAAGCTATAGCCTGTCAGTGT
GTTGTCTTTCAGTCCCTGTGGGTTTCTATCTTCTAGCTCCTAAAGGTCGC
CGTGTGAGCGGAGCTGCTGCTTGGGCAGGAGTGCTCGTTGGTGCTCTGGG
CTATGGATGGGTTCAGATAGTCTCTTTGGGGATGTTTGGGGAGCTATTGG
CTTGGGTAGGTTCTCTAGTCGCCTTTTCCTTTGTAGGATTTATTGAGATC
ACTTGGAAAAACAAAGTCAAAACGCAAACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy