Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR389 IGR384 IGR387 IGR386 IGR390 IGR388 artJ, - CPn0482 CPn0489 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 artJ, - CPn0482 CPn0489 CPn0486 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 artJ, - CPn0482 CPn0489 CPn0486 CPn0487 hitA,ycfH, - CPn0488 hitA,ycfH, - CPn0488 CPn0485 aroG, - CPn0484 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0485

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
566038

Gene Stop:
566232

Gene Length:
195

Molecular Weight*:
7514

pI*:
8.50

Net Charge*:
3.27

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0485 is similar to CT382.1, a Chlamydia-specific hypothetical protein: residues 1-59 are 47% similar to that of CT382.1.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
64

PDB Hit:


Gene Protein Sequence:
MIKQACKFYLLQCLLCALYWLLKYCRKLLKGTLHHSEETLYQALLSSLID
LLYQLKQLPAPTNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAAACAAGCGTGTAAATTTTACCTTTTACAGTGTTTACTTTGCGC
TCTGTATTGGCTATTAAAGTATTGCAGAAAGCTTCTTAAGGGCACTCTTC
ACCATTCTGAAGAGACGCTCTATCAAGCCCTGCTCTCCTCTCTTATCGAC
CTGCTCTATCAGTTAAAACAGCTTCCCGCCCCTACGAATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy