Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR383 IGR389 IGR384 IGR387 IGR386 IGR388 artJ, - CPn0482 CPn0489 CPn0486 CPn0481 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 artJ, - CPn0482 CPn0489 CPn0486 CPn0481 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 artJ, - CPn0482 CPn0486 CPn0481 CPn0487 hitA,ycfH, - CPn0488 CPn0489 hitA,ycfH, - CPn0488 CPn0485 aroG, - CPn0484 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0484

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroG  

Definition:
phospho-2-dehydro-3-deoxyheptonate aldolase

Gene Start:
564970

Gene Stop:
565827

Gene Length:
858

Molecular Weight*:
31294

pI*:
6.70

Net Charge*:
-2.47

EC:
4.1.2.15  

Functional Class:
amino acid biosynthesis; aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to aldolase and chorismate mutase sequences.
CPn0484 is similar to CT382, a predicted aldolase.
Residues 12-266 are 66% similar to CT382. Residues 36-265 are 43%
similar to AROG_BACSU.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant matches. Weak similarity to DAHP synthetase blocks.

ProDom Summary:  Protein Domain Search
Residues 42-264 are 47% similar to an aldolase synthase domain of P72864_XXXXX.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae. CPn0484 is weakly similar to CPn0721,
a predicted KDO synthase.

Pfam Summary:  Pfam Search
Residues 26 to 279 (E-value = 4.3e-121) place CPn0484 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:


Gene Protein Sequence:
LHEVLILTFTYPLPRTLKQHPDEVHTVPISPNLSFGEGSPILIAGPCTLE
SYEHTVSSALTVKEAGAQVFRGSIRKPRTSPFSFQGWEKECVLWHKEAQS
IHGLPTETEVLDVRDVEITAEHVDILRIGAKNMHNTPLLQEVSKSHRPII
LKRSPAATLEEWLCAAEYILASSPSCPGVILCERGIRTFEHSTRYTLDLN
TVALLKEISSLPVIVDPSHAAGKRSLVLPLASAGLSVGADGLMIEVHAHP
EKALCDAKQQITPEELHLFAKKHFCPSESRAHAIS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCATGAGGTACTTATTCTTACGTTTACCTATCCCCTACCGCGCACCCT
CAAACAGCATCCTGACGAGGTCCATACCGTTCCTATTTCTCCAAATCTAT
CGTTTGGAGAAGGATCGCCAATACTGATCGCAGGCCCCTGCACCTTAGAA
AGTTACGAGCATACAGTCTCTTCAGCTCTTACAGTTAAAGAAGCAGGAGC
TCAGGTATTCCGAGGATCAATCAGAAAACCACGGACAAGCCCATTTTCGT
TTCAAGGATGGGAGAAAGAGTGTGTGCTTTGGCATAAGGAAGCACAGAGC
ATCCATGGTCTCCCTACAGAAACCGAAGTTTTAGATGTCCGAGATGTTGA
AATTACTGCCGAACATGTGGATATCCTCCGTATCGGAGCCAAAAACATGC
ATAACACCCCTCTTTTACAAGAGGTCAGCAAATCACATCGTCCGATTATC
CTAAAACGCAGTCCAGCAGCTACTCTTGAAGAGTGGCTATGCGCAGCGGA
GTACATCCTTGCTTCTTCTCCCTCCTGTCCTGGGGTAATCCTTTGTGAAC
GAGGAATTCGTACCTTTGAGCACTCTACGCGCTACACGCTAGATCTCAAT
ACCGTGGCTCTCCTTAAAGAGATCTCTTCTCTCCCTGTAATTGTAGATCC
TTCCCACGCAGCGGGGAAGCGTTCTCTAGTTCTTCCTCTCGCCTCTGCTG
GTCTCTCGGTAGGTGCCGACGGTCTGATGATCGAAGTGCATGCACACCCT
GAAAAGGCTCTTTGTGACGCGAAGCAACAGATCACGCCCGAGGAGCTTCA
CCTATTTGCTAAAAAGCACTTCTGCCCATCAGAATCACGGGCTCATGCGA
TTTCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy