Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR383 IGR382 IGR384 IGR387 IGR386 IGR381 IGR388 CPn0480 artJ, - CPn0482 phnP, - CPn0479 CPn0486 CPn0481 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 CPn0480 artJ, - CPn0482 phnP, - CPn0479 CPn0486 CPn0481 CPn0487 CPn0485 aroG, - CPn0484 CPn0483 artJ, - CPn0482 phnP, - CPn0479 CPn0486 CPn0481 CPn0487 CPn0480 CPn0485 aroG, - CPn0484 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0483

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
561836

Gene Stop:
564967

Gene Length:
3132

Molecular Weight*:
118557

pI*:
8.10

Net Charge*:
11.78

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0483 is weakly similar to UU046, a hypothetical protein in U. urealyticum: residues 72-163 are 34% similar to UU046. No significant similarities to M. genitalium or T. pallidum sequences.

CPn0483 is similar to CT868, a predicted conserved hypothetical protein. Residues 20-164 are 33% similar to CT868.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
45  
62
non-globular  
73  
153
non-globular  
535  
670

PDB Hit:


Gene Protein Sequence:
LIKKRAIFERMFPIPPPHCPPNNKNNFYHLTTDTKDPLLLRILRTIGYVL
LHIITLGLLLLIHYYKHHRVVRKEGLPTPPTLPKGPEPKTIEIAKQPPKD
GEDKKPDVPKPGTPPPEDTPPPPPKAPSPASPKVPKQPADKKPTPPPEAP
PPPVRVATPMPLRPSSQGYWQCLNRMVSMVLRRAPLPLPAMQVDPILGDF
NPHFVASYPNRIDNEPMYFQIKQFKKIAQNPDLPQQHRRLAQLSLEQALY
LNDNYYLVNVPGDGNCFYRAYAVGWLSALYEESSRNDIVFEQEATRLLDL
PFASSSPANANLCAEMAELLQLCSTYCSFIDLYDGVILSQKHTATLIAFL
RKLSAYAIRQQIAASSNEETARALFISDMQDDLLPSVLEFLAANRPYSEL
FQNLIDHSALPYMQSRDKLFLLLEHLPALFLTDAELQKMSPEDQQLRKQY
EREIREAFAKLSRRIADSGWDTERFNAIVKDHLPEAIRCQYSRFLATIEN
RRSGDLPWSPALSFFAFLCTCPSVRFHKLCATFYKSLEDIIIASAPPQRS
IQEILQISNASLSYLNEDLDSSWQREVISSNIMTILTTHESLTLESSMPQ
LETLHKRIANLLKNVISTSFETPPLSNQPDLLSNLVNKLLVAIHSKLELK
EHFNTVCSARSLRLTRDEGSGLSQEQDLLYTQAVQLLFFILQHPQVNNRP
ETKDAVKELKMLLLPFLQYAFKKVENEKKLQKLLRSILGSLVLKPPARYP
STPSNKDKETFCKFWSRHPEVMVLDPILEKNCMQFLRATFPNYQLETEAI
LLEKEIESTFRNGWNVFLTRLNLFGSKLGSPSSPTALSDQFSKSFLIFCF
LNNYPKLLQKKTPLAARLDAFQREASHRFTQVKDKLLLSLKYGFPLATAT
INQYSRARDQLICNLLKNTVTASDGFCRSGFRQSLIGYLHSLSSNELGDI
LDDVKEQAEANDVAAMTTVPLQPFAVCLIMSDRDTVSEENIENFVAMHGF
LNTISPERDARIFLIRFPNHYGCLLPRNPRTEDQNSKPDSSNP$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTAAAAAACGAGCAATTTTTGAACGTATGTTTCCAATTCCCCCACC
ACATTGCCCGCCCAATAACAAGAATAATTTTTACCACTTAACGACTGATA
CTAAAGACCCTCTGTTACTTAGAATTCTACGTACCATAGGATACGTTCTG
CTCCATATCATTACTCTTGGTTTGCTTCTTCTGATTCACTACTACAAGCA
TCATCGGGTTGTCAGAAAAGAAGGCTTGCCAACGCCTCCCACTCTTCCCA
AAGGACCAGAGCCAAAAACTATAGAAATTGCCAAACAACCGCCTAAGGAT
GGTGAAGACAAAAAACCCGATGTTCCCAAGCCGGGCACGCCGCCCCCAGA
GGACACACCCCCGCCTCCCCCCAAAGCTCCTTCACCAGCGAGCCCAAAAG
TCCCTAAACAACCTGCTGATAAAAAGCCGACTCCACCACCAGAGGCCCCT
CCTCCTCCCGTACGGGTGGCTACCCCCATGCCTCTCCGCCCATCTAGTCA
AGGCTATTGGCAATGCTTAAATCGCATGGTGAGCATGGTACTAAGACGAG
CGCCTCTGCCTCTTCCTGCCATGCAAGTTGATCCAATACTTGGCGACTTT
AACCCTCATTTCGTAGCTTCCTATCCCAATCGGATTGATAACGAACCGAT
GTATTTCCAAATAAAACAGTTCAAGAAAATCGCACAAAATCCGGATCTTC
CTCAACAACACCGGCGACTTGCGCAACTCTCTCTTGAACAGGCTCTCTAT
CTAAATGACAATTACTACCTTGTGAATGTACCGGGAGATGGGAACTGCTT
TTATCGTGCCTATGCTGTAGGATGGCTATCTGCTCTCTACGAAGAGAGCA
GCAGAAATGATATTGTCTTTGAGCAGGAAGCCACACGTCTCCTTGACCTG
CCTTTCGCCTCCTCTTCTCCGGCAAATGCGAATCTTTGTGCAGAAATGGC
TGAACTCCTTCAGTTATGCAGTACTTATTGCTCCTTCATAGACCTCTATG
ACGGGGTGATTCTTTCTCAGAAACACACTGCAACTCTGATAGCCTTTCTA
AGAAAACTCTCTGCATATGCGATTCGCCAACAAATCGCAGCTTCAAGTAA
TGAAGAAACAGCGAGAGCCTTATTTATTTCTGATATGCAGGACGATCTCC
TCCCCAGTGTTCTGGAATTTCTTGCTGCAAATCGTCCCTATTCGGAATTG
TTCCAAAATCTCATTGATCATTCCGCACTTCCTTACATGCAATCTAGAGA
CAAACTCTTTCTTCTCTTGGAACATCTGCCCGCTCTCTTTCTTACTGATG
CAGAGCTTCAAAAGATGTCTCCAGAAGATCAACAACTTCGAAAGCAATAT
GAAAGAGAAATACGAGAGGCTTTTGCTAAGCTGAGTCGACGCATTGCTGA
TTCAGGGTGGGATACTGAGAGATTCAATGCTATAGTCAAAGATCACCTCC
CTGAAGCAATCCGATGTCAATACTCTCGCTTTCTTGCAACTATAGAAAAC
AGACGATCTGGGGATCTCCCTTGGTCTCCAGCTCTTTCTTTCTTTGCTTT
TCTATGTACCTGCCCCTCTGTAAGATTTCACAAACTCTGCGCTACTTTCT
ACAAATCATTAGAGGATATCATTATAGCGTCCGCGCCCCCCCAACGCTCT
ATACAAGAGATCTTACAAATAAGTAACGCCTCCCTCAGCTACCTTAATGA
AGATTTAGATTCTTCTTGGCAACGAGAGGTGATTTCTTCTAACATCATGA
CTATCCTTACGACTCATGAGAGTTTGACGTTAGAGAGCTCTATGCCTCAA
CTCGAAACACTACATAAACGCATAGCAAACCTATTAAAGAATGTAATATC
CACATCCTTTGAAACCCCTCCTTTAAGCAATCAGCCGGATTTACTTTCAA
ATCTTGTAAACAAGCTATTAGTCGCAATTCATAGTAAGCTTGAATTAAAA
GAGCACTTCAATACTGTCTGCTCGGCAAGAAGTTTACGTTTAACGCGTGA
TGAAGGCAGTGGTCTCTCACAAGAGCAGGACCTCCTCTATACACAGGCAG
TACAGCTCTTATTCTTTATTTTACAGCATCCTCAAGTGAATAATCGTCCA
GAAACTAAAGATGCCGTTAAAGAGTTAAAAATGCTTCTACTTCCTTTTCT
ACAATATGCCTTTAAAAAAGTAGAAAACGAAAAGAAACTCCAAAAACTTC
TACGTTCCATTCTAGGGTCTCTAGTACTCAAGCCTCCAGCACGCTATCCT
TCAACCCCTTCTAATAAAGATAAAGAGACGTTCTGCAAGTTCTGGTCACG
ACATCCTGAAGTGATGGTTTTAGATCCCATACTTGAAAAGAACTGTATGC
AGTTTCTACGAGCTACTTTCCCAAATTATCAACTGGAAACCGAGGCCATA
CTCTTAGAAAAAGAAATCGAAAGTACCTTTAGGAATGGGTGGAACGTTTT
TTTAACACGGTTAAATCTCTTCGGATCAAAACTGGGTTCGCCTTCTTCTC
CCACAGCTTTAAGTGATCAGTTTTCGAAATCTTTTTTAATCTTTTGTTTC
CTTAACAACTACCCTAAACTTCTACAAAAAAAGACTCCGCTAGCTGCTCG
ATTAGACGCTTTCCAAAGAGAGGCTTCTCATAGATTTACACAAGTAAAAG
ATAAGCTTTTACTTTCGTTAAAATACGGTTTCCCTCTAGCTACAGCGACT
ATAAATCAATACTCTAGAGCTCGAGATCAGTTGATTTGTAATCTCTTAAA
AAACACGGTCACAGCATCTGATGGTTTCTGTCGCTCTGGTTTTAGACAAT
CACTGATAGGCTACCTCCACTCCCTAAGTTCTAATGAACTCGGTGATATC
TTGGATGACGTCAAAGAGCAAGCTGAGGCTAACGACGTCGCTGCTATGAC
TACTGTACCTTTGCAGCCGTTTGCTGTTTGTCTGATCATGTCTGATCGAG
ATACTGTCTCAGAAGAAAATATTGAAAACTTTGTTGCGATGCATGGATTT
TTAAATACAATTTCTCCGGAAAGAGACGCTCGTATCTTCTTAATCCGCTT
CCCCAACCACTACGGTTGTCTCTTGCCTAGAAACCCTAGAACTGAAGATC
AGAACTCAAAACCGGACAGCTCAAATCCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy