Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR383 IGR382 IGR384 IGR387 IGR386 IGR381 CPn0480 artJ, - CPn0482 hflX, - CPn0478 CPn0481 CPn0485 aroG, - CPn0484 CPn0483 CPn0480 artJ, - CPn0482 hflX, - CPn0478 CPn0481 CPn0485 aroG, - CPn0484 CPn0483 CPn0480 artJ, - CPn0482 hflX, - CPn0478 CPn0481 phnP, - CPn0479 phnP, - CPn0479 CPn0485 aroG, - CPn0484 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0482

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
artJ  

Definition:
possible arginine-binding periplasmic protein

Gene Start:
561737

Gene Stop:
560958

Gene Length:
780

Molecular Weight*:
29055

pI*:
5.30

Net Charge*:
-3.69

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
In E.coli, the HISJ protein is a component of the histidine permease system, a periplasmic protein. The ARTJ protein is an arginine-binding protein that is part of the periplasmic transport system.


Blast Summary:  PSI-Blast Search
CPn0482 is similar to CT381, a possible arginine-binding periplasmic protein.
Residues 20-254 are 61% similar to CT381.
Significant hits in gapped BLAST to periplasmic binding protein sequences; e.g. residues 25-123 are 28% similar to TP0308, a predicted amino acid ABC transporter, periplasmic binding protein/ possible FliY (sulfate starvation induced protein 7); residues 34-251 are 32% similar to (AE001734) amino acid ABC transporter, periplasmic amino acid-binding protein [Thermotoga maritima]; residues 36-251 are 31% similar to ARTJ_ECOLI; and residues 37-251 are 31% similar to ARTI_ECOLI.
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0834
COG name: Periplasmic amino acid binding proteins
Functional Class:  E
The phylogenetic pattern of COG0834 is A-----VCEBrHUJ---LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 48-68 and 82-114 represent blocks BL01039A-B (Bacterial extracellular solute-binding proteins, family 3 sig) with a combined E-value of 1.8e-17.

ProDom Summary:  Protein Domain Search
Residues 36-251 are 31% similar to a defined domain of ARTJ_ECOLI, defined as: RECEPTOR GLUTAMATE PRECURSOR PROTEIN SIGNAL MEMBRANE TRANSPORT SUBUNIT PERIPLASMIC IONIC.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 33 to 255 (E-value = 1.1e-25) place CPn0482 in the SBP_bac_3 family which is described as Bacterial extracellular solute-binding proteins, family 3 (PF00497)

PDB Hit:


Gene Protein Sequence:
MIKQIGRFFRAFIFIMPLSLTSCESKIDRNRIWIVGTNATYPPFEYVDAQ
GEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSI
TPSRQKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQYSSVAVQTGTFQ
EHYLLSQPGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNL
VATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKK
WQLSEVAYE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAAACAAATAGGCCGTTTTTTTAGAGCATTTATTTTTATAATGCC
TTTATCTTTAACAAGTTGTGAGTCTAAAATCGATCGAAATCGCATCTGGA
TTGTAGGTACGAATGCTACATATCCTCCTTTTGAGTATGTGGATGCTCAG
GGGGAAGTTGTAGGTTTCGATATAGATTTGGCAAAGGCAATTAGTGAAAA
ACTTGGCAAGCAATTGGAAGTTAGAGAATTCGCTTTCGATGCTTTAATTT
TAAATTTAAAAAAACATCGTATCGATGCAATTTTAGCAGGAATGTCCATT
ACTCCTTCGCGTCAGAAGGAAATCGCCCTGCTTCCCTATTATGGCGATGA
GGTTCAAGAGCTGATGGTGGTTTCTAAGCGGTCTTTAGAGACCCCTGTGC
TTCCCCTAACACAGTATTCTTCTGTTGCTGTTCAGACAGGAACGTTTCAG
GAGCATTATCTTTTATCTCAGCCCGGAATTTGTGTCCGTTCTTTTGATAG
CACCTTGGAGGTGATTATGGAAGTTCGTTATGGGAAATCTCCGGTTGCCG
TTCTAGAACCCTCGGTAGGACGTGTCGTTCTTAAAGACTTCCCTAATCTT
GTTGCAACAAGATTAGAGCTCCCTCCTGAATGTTGGGTGTTGGGCTGTGG
TCTCGGCGTAGCTAAAGATCGTCCTGAAGAAATACAAACGATTCAACAAG
CGATTACAGATTTAAAGAGCGAAGGGGTGATTCAATCTTTAACCAAGAAA
TGGCAACTTTCTGAAGTTGCTTACGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy