Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR385 IGR383 IGR382 IGR384 IGR380 IGR381 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 aroG, - CPn0484 CPn0483 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 aroG, - CPn0484 CPn0483 Type: tandem, Name:  - 8 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 phnP, - CPn0479 phnP, - CPn0479 aroG, - CPn0484 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0481

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
560946

Gene Stop:
559336

Gene Length:
1611

Molecular Weight*:
60406

pI*:
4.60

Net Charge*:
-22.73

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
61
transmembrane  
66  
83
non-globular  
119  
190
coil-coil  
292  
326

PDB Hit:


Gene Protein Sequence:
MATSVPVTSSTSVGEANSSNERFTERTSRMYYAALVLGALSCLIFIAMIV
IFPQVGLWAVVLGFALGCLLLSLAIVFAVSGLVLGKTLEPSREATPPEIV
AQKEWTTQQDVLGNEYWRSELISLFLRGDLHESLIVDSKDRSLDIDQSLQ
NILKLEPLSTTLSLLKKDCVHINIILHLVRQWNLLGVDLSPEVTAHAEEL
LLFLIEEQYYSPDILKLIRYGDALQATSPLMDWADSGSFSVDADGVFSCR
REECSPEDALAQFDLLLALENPDRRFLKDSFLTYIWSSSFFEKFLHRHLE
SLQRKLPETAIDVARYEAQIQTFLSRYFQKLDLINAMSLDWGYNCAEGEK
CYESANQRLDNLFIAFSSSVPAMKRLFDKYGSVVRVDRRQIREQILSNTE
ILENESGFLCSLYEYPLSYLIDWAVLLDCVRGTEISLEDQADYTVCLQGL
DSMLSQFASRLQSGQKVLNPRDVLSEQAAVMLVHGLAAQGVSFQGLKALM
YLTAVPQRMWLGALPLFESFPVFNRMKEFLGESLGD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACCTCTGTTCCTGTAACTTCATCTACTTCTGTAGGAGAGGCTAA
CTCCTCCAACGAAAGATTTACTGAACGAACATCGCGAATGTATTACGCAG
CTTTAGTCCTAGGGGCTTTGAGCTGTTTAATTTTTATTGCTATGATTGTC
ATTTTCCCACAGGTCGGATTGTGGGCTGTGGTCCTCGGGTTTGCTCTTGG
ATGTTTACTTTTAAGCTTAGCTATCGTTTTTGCTGTCTCCGGTCTCGTTT
TAGGCAAGACTTTAGAACCTAGTCGAGAAGCGACTCCTCCAGAAATTGTT
GCGCAAAAGGAGTGGACTACACAACAAGATGTCTTAGGGAATGAGTATTG
GCGTTCCGAGTTGATTTCCTTGTTCTTACGAGGGGATCTCCACGAATCTC
TGATTGTTGATTCTAAGGATCGATCTTTAGATATTGATCAGAGTTTACAA
AATATATTGAAACTTGAGCCCCTATCTACGACACTTTCGCTGTTAAAGAA
AGATTGTGTCCACATCAATATCATTTTACATTTAGTGAGACAGTGGAACT
TACTGGGAGTGGATCTTAGTCCTGAAGTCACTGCGCACGCCGAGGAACTT
CTACTCTTTTTGATAGAAGAGCAGTATTACTCTCCTGATATTTTGAAATT
GATTCGCTACGGAGATGCTTTACAAGCAACGTCTCCTTTGATGGATTGGG
CAGATTCAGGTTCCTTTAGTGTAGACGCAGACGGGGTATTTAGCTGTCGC
AGAGAAGAATGTTCTCCTGAGGATGCTTTGGCGCAATTCGATCTTCTTTT
GGCGTTGGAAAATCCCGACAGACGCTTCTTAAAGGATTCTTTTCTTACCT
ACATTTGGTCGTCTTCATTTTTTGAGAAGTTTTTACATCGCCATCTAGAG
AGCTTGCAAAGAAAGCTCCCAGAGACAGCGATCGATGTCGCCCGCTATGA
AGCACAAATACAAACATTTCTCTCTCGCTATTTTCAGAAGCTCGATTTGA
TAAACGCAATGTCCTTAGATTGGGGATATAACTGTGCTGAGGGAGAAAAA
TGTTATGAGAGCGCAAATCAAAGATTAGACAACCTATTTATTGCTTTTTC
TTCTTCTGTTCCTGCTATGAAGCGGCTCTTTGACAAATATGGTTCTGTGG
TACGGGTAGATCGTAGGCAGATTCGTGAGCAGATTCTTTCGAACACTGAA
ATCTTAGAAAATGAGTCAGGGTTCCTCTGCAGTTTGTATGAATATCCTTT
ATCCTATTTGATAGATTGGGCTGTTTTGCTAGACTGTGTTCGCGGTACCG
AAATCTCTCTAGAAGATCAGGCCGATTACACCGTTTGTTTGCAAGGCTTG
GATTCTATGTTATCTCAATTTGCGAGTCGTTTACAGTCTGGACAAAAAGT
ATTGAATCCTAGAGATGTTTTAAGTGAACAGGCTGCGGTTATGCTTGTTC
ATGGCTTGGCAGCACAGGGCGTGTCGTTTCAAGGATTGAAAGCTTTGATG
TATTTGACAGCCGTTCCCCAAAGAATGTGGTTAGGAGCATTGCCTTTATT
TGAATCTTTTCCTGTCTTTAATCGGATGAAAGAATTTCTTGGGGAATCTC
TGGGAGACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy