Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR383 IGR382 IGR384 IGR380 IGR381 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 CPn0483 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 CPn0483 Type: tandem, Name:  - 8 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0480

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
559303

Gene Stop:
558647

Gene Length:
657

Molecular Weight*:
23812

pI*:
7.40

Net Charge*:
1.62

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0480 is similar to CT383, a hypothetical protein. Residues 1-201 are 35% similar to CT383.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
29  
46
transmembrane  
108  
132
transmembrane  
137  
159

PDB Hit:


Gene Protein Sequence:
MLGSLPCYPGAGNIEEYKNRYFYCQLCAEVVSPYVVPVIVVDVQGAPPTG
ILQVLRCKQHKFQGLPVHGPITSLWALEPVGKGAPQLESAMYELCSQVRN
FDICSIVSWVFGGLCIFAGLIVGVMVEAPLIAGLSAWVIPCIIGGVGAIL
CLFAILMAYLGRGRVREWLNLSHEYITQCHCRQIQAHSQNYSVITEYPAT
CALSQPITKLPNGSRRDN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGGTTCTTTGCCATGTTATCCTGGTGCTGGCAATATTGAAGAATA
CAAAAATAGGTATTTCTATTGTCAGTTATGTGCTGAGGTCGTTAGTCCCT
ATGTTGTTCCTGTTATTGTAGTTGATGTGCAAGGGGCTCCTCCTACAGGT
ATCTTGCAGGTCTTGCGTTGTAAGCAACATAAATTTCAAGGCCTACCCGT
ACATGGCCCCATTACTTCTTTATGGGCTTTGGAGCCCGTGGGTAAGGGAG
CTCCGCAGCTGGAGTCTGCAATGTACGAGCTCTGTTCTCAAGTAAGGAAT
TTTGACATCTGCTCTATTGTGAGTTGGGTCTTTGGTGGGTTGTGTATTTT
TGCAGGTCTGATTGTCGGGGTAATGGTTGAAGCCCCTTTGATTGCGGGAT
TAAGTGCTTGGGTGATTCCCTGTATCATTGGAGGGGTTGGTGCCATTTTA
TGCTTGTTTGCGATCTTGATGGCGTACTTGGGAAGAGGGAGAGTCCGTGA
GTGGCTCAATCTTTCACACGAATATATAACGCAATGTCATTGTCGTCAGA
TACAGGCACATTCTCAAAACTATTCTGTGATCACAGAGTATCCTGCAACC
TGTGCATTATCTCAACCGATTACAAAGTTACCTAATGGATCACGCAGAGA
TAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy