Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR383 IGR382 IGR384 IGR380 IGR381 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 CPn0483 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 CPn0483 Type: tandem, Name:  - 8 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0479

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
phnP  

Definition:
probable PhnP-like protein

Gene Start:
558425

Gene Stop:
557613

Gene Length:
813

Molecular Weight*:
30216

pI*:
5.50

Net Charge*:
-8.68

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0479 is orthologously related to CT380: residues 6-269 of CPn0479 are 55% similar to residues 3-266 of CT380, a predicted probable PhnP-like protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1235
COG name: Metal-dependent hydrolases of the beta-lactamase superfamily I
Functional Class:  R
The phylogenetic pattern of COG1235 is amtK-q-CeB------o-INx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 42 to 242 (E-value = 9.5e-15) place CPn0479 in the Lactamase_B family which is described as Metallo-beta-lactamase superfamily (PF00753)

PDB Hit:


Gene Protein Sequence:
MVRDIQSESIGKLVFLGTGNPEGIPVPFCSCRVCQNTGIHRLRSSVLIQY
QNKTLVIDAGPDFRTQMLVAGVSELDGVFLTHPHYDHIGGIDDLRAWYIV
TQRSLPLVLSASTYRFLNKAKEYLFATPNVESSLPAVLEFTILNEDCGQE
EFQGIPYTYVSYYQKSCHVTGFRFGNLAYLTDLCSYDAKIFSYLDNVETL
ILSAGPSETPIPFQGHKSSHLTVEEAKAFANHAGIKNLIITHISHCLEAE
RDQHPEVTFAYDGMEVLWTL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAAGAGATATTCAGAGTGAATCTATAGGGAAATTAGTATTTTTAGG
CACAGGAAATCCCGAAGGAATTCCCGTGCCGTTTTGCTCATGTAGAGTGT
GTCAAAACACAGGGATTCATCGTTTACGATCTTCGGTACTCATTCAATAT
CAAAACAAGACTCTAGTGATTGACGCAGGCCCTGATTTTCGTACGCAGAT
GTTAGTTGCAGGGGTTTCCGAGCTCGATGGGGTATTTCTGACCCATCCCC
ACTACGATCATATCGGTGGTATTGATGATTTACGTGCGTGGTACATAGTC
ACGCAGCGTTCGTTGCCTTTGGTCCTTTCTGCAAGCACCTATAGATTTTT
AAACAAGGCTAAAGAGTATCTCTTCGCCACTCCGAATGTAGAGTCTTCAC
TTCCCGCAGTTTTAGAGTTTACAATCTTGAATGAGGACTGTGGGCAGGAG
GAATTTCAGGGCATTCCCTATACTTATGTTTCCTATTATCAAAAGTCGTG
CCATGTAACGGGTTTTCGTTTTGGAAATCTTGCTTATCTTACAGATCTCT
GTAGCTATGATGCAAAAATTTTCAGTTACTTAGATAATGTAGAGACATTG
ATCTTGTCTGCGGGTCCATCGGAAACTCCTATTCCTTTTCAGGGACACAA
ATCTTCGCATCTTACTGTAGAAGAAGCCAAAGCTTTTGCGAATCATGCAG
GGATAAAGAATTTAATTATTACACATATCAGCCACTGTTTAGAAGCAGAG
CGTGACCAGCATCCAGAGGTCACATTTGCTTATGATGGCATGGAGGTCCT
TTGGACACTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy