Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR383 IGR382 IGR384 IGR380 IGR381 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 CPn0483 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 CPn0483 Type: tandem, Name:  - 8 CPn0480 artJ, - CPn0482 CPn0477 hflX, - CPn0478 CPn0481 glgB, - CPn0475 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476 CPn0483
* Calculated from Protein Sequence

Gene ID: CPn0478

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hflX  

Definition:
HFLX-related GTP-binding protein

Gene Start:
557625

Gene Stop:
556207

Gene Length:
1419

Molecular Weight*:
52733

pI*:
6.90

Net Charge*:
-0.73

EC:
 

Functional Class:
cellular processes; signal transduction  
uncategorized  

Pathway: pathway table

Comment:
In E.coli, the hflA locus governs stability of lambda cII. Attached to the locus
is the hflX gene which appears to encode a 50 kDa polypeptide.
See CT379.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GTP-binding protein sequences; e.g. residues 54-446 are 37% similar to (AF145049) ATP/GTP-binding protein [Streptomyces fradiae]; residues 51-443 are 38% similar to (AB014075) GTPase [Clostridium histolyticum]; and residues 52-407 are 36% similar to HFLX_ECOLI.
CPn0487 is similar to CT379, a predicted hflX HFLX-related GTP-binding protein.
Residues 11-448 are 70% similar to CT379.

COGS Summary:  COGS Search
BeTs to 9 clades of COG2262
COG name: GTPases, the HflX family
Functional Class:  R
The phylogenetic pattern of COG2262 is amtk-QVCEBrhUJ---L-NX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 230-273 and 341-355 represent blocks BL00905B,D (GTP1/OBG family proteins) with an E-value of 8.5e-06.

ProDom Summary:  Protein Domain Search
Residues 54-222 are 42% similar to a defined domain of HFLX_ECOLI, defined as: PROTEIN GTP-BINDING HFLX YNBA 426AA LONG.
Residues 233-352 are 48% similar to a defined domain of P73965_XXXXX, defined as: PROTEIN GTP-BINDING LIPOPROTEIN PRENYLATION TRANSPORT FACTOR RAS-RELATED ELONGATION ADP-RIBOSYLATION BIOSYNTHESIS.

Paralogs:  Local Blast Search
Very weak evidence of paralogy to CPn0544 and CPn0838: residues 176-390 are 26% similar to CPn0544; and residues 234-395 are 27% similar to CPn0838.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LDTIDTPGEQGSQSFGNSLGARFDLPRKEQDPSQALAVASYQNKTDSQVV
EEHLDELISLADSCGISVLETRSWILKTPSASTYINVGKLEEIEEILKEF
PSIGTLIIDEEITPSQQRNLEKRLGLVVLDRTELILEIFSSRALTAEANI
QVQLAQARYLLPRLKRLWGHLSRQKSGGGSGGFVKGEGEKQIELDRRMVR
ERIHKLSAQLKAVIKQRAERRKVKSRRGIPTFALIGYTNSGKSTLLNLLT
AADTYVEDKLFATLDPKTRKCVLPGGRHVLLTDTVGFIRKLPHTLVAAFK
STLEAAFHEDVLLHVVDASHPLALEHVQTTYDLFQELKIEKPRIITVLNK
VDRLPQGSIPMKLRLLSPLPVLISAKTGEGIQNLLSLMTEIIQEKSLHVT
LNFPYTEYGKFTELCDAGVVASSRYQEDFLVVEAYLPKELQKKFRPFISY
VFPEDCGDDEGRGPVLESSFGD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGACACTATAGATACGCCCGGGGAACAGGGTTCTCAATCTTTCGGAAA
TTCGTTAGGGGCCAGGTTCGACTTGCCTCGTAAGGAACAGGATCCCTCTC
AAGCTTTAGCTGTGGCTTCCTATCAAAATAAGACAGATTCTCAGGTCGTT
GAAGAACATTTAGACGAGTTGATCTCACTTGCGGATTCCTGTGGTATTTC
TGTTTTAGAGACCCGTTCTTGGATTTTAAAAACACCCTCAGCTTCCACCT
ATATCAATGTGGGGAAGTTGGAGGAGATCGAAGAAATCTTGAAAGAGTTT
CCCTCTATAGGGACTTTGATCATAGATGAGGAGATCACTCCATCCCAACA
ACGGAATTTAGAGAAACGCCTTGGCCTTGTCGTTTTGGATAGGACGGAGT
TAATTTTGGAAATCTTTTCCAGCCGTGCCCTTACTGCAGAGGCAAATATC
CAAGTCCAACTTGCACAAGCACGTTATCTCCTTCCTCGTCTTAAGAGACT
TTGGGGGCACCTATCTCGGCAAAAATCTGGGGGAGGTAGCGGAGGCTTTG
TTAAGGGGGAAGGAGAAAAACAGATCGAGCTAGACCGTAGAATGGTCCGT
GAGCGTATCCATAAGCTGTCAGCACAGCTGAAAGCTGTGATCAAACAGCG
TGCGGAACGCCGTAAAGTAAAATCTCGACGAGGAATTCCTACCTTTGCTT
TGATAGGGTATACAAATTCAGGGAAGAGCACCCTATTAAATTTGCTGACG
GCTGCTGATACGTATGTTGAAGACAAGCTATTTGCAACTTTAGATCCCAA
AACGCGCAAATGCGTACTTCCAGGAGGCCGTCATGTCCTTCTTACTGATA
CTGTAGGCTTCATTCGAAAACTTCCTCATACTTTGGTAGCAGCATTTAAA
AGTACTTTAGAAGCAGCTTTCCATGAAGATGTTCTTCTGCATGTTGTCGA
TGCTTCGCATCCTTTAGCTTTAGAGCATGTACAGACGACCTACGATCTCT
TTCAAGAGTTGAAGATTGAAAAGCCTAGGATCATTACTGTGTTGAATAAG
GTAGATCGGCTTCCTCAAGGAAGTATCCCTATGAAATTACGTTTGCTCTC
TCCTCTTCCTGTATTGATTTCAGCAAAAACTGGGGAGGGGATCCAGAATC
TTCTTAGTCTTATGACGGAAATCATTCAGGAGAAAAGTTTGCATGTGACT
TTGAATTTTCCTTATACAGAATATGGAAAATTTACGGAACTTTGCGATGC
CGGGGTTGTGGCCTCGTCAAGGTATCAAGAAGATTTTTTAGTTGTTGAAG
CGTATCTTCCTAAGGAGCTGCAAAAGAAATTTCGTCCTTTTATTTCTTAT
GTTTTCCCTGAAGATTGTGGAGATGACGAGGGTAGAGGGCCCGTCTTGGA
GAGTTCTTTCGGGGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy