Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR382 IGR380 IGR378 IGR381 CPn0480 CPn0477 hflX, - CPn0478 CPn0481 CPn0474 glgB, - CPn0475 CPn0480 CPn0477 hflX, - CPn0478 CPn0481 CPn0474 glgB, - CPn0475 Type: tandem, Name:  - 8 CPn0480 CPn0477 hflX, - CPn0478 CPn0481 CPn0474 glgB, - CPn0475 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476
* Calculated from Protein Sequence

Gene ID: CPn0477

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
556106

Gene Stop:
554841

Gene Length:
1266

Molecular Weight*:
47206

pI*:
6.50

Net Charge*:
-2.65

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to conserved hypothetical sequences; residues 13-374 are 34% similar to (AF036764) unknown [Clostridium acetobutylicum]; and residues 15-392 are 30% similar to YQEV_BACSU.

A search of the STD-pro database reveals signficant similarity to TP0754 and TP0269, both of which are conserved hypothetical protein sequences. No significant similarity to C.trachomatis, M.genitalium, or U.ureaplasma.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0621
COG name: Fe-S oxidoreductases family 1
Functional Class:  C
The phylogenetic pattern of COG0621 is amtk-QVCEBrhUJ---L-NX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 14-329 span 9 regions of similarity to blocks BL0127A-H (Uncharacterized protein family UPF0004 proteins.)

ProDom Summary:  Protein Domain Search
Residues 35-221 are 32% similar to YQEV_BACSU.

Residues 228-369 are 39% similar to an oxidoreductase domain of O69963_STRCO

Paralogs:  Local Blast Search
Residues 7-373 are 27% similar to CPn0251, a sequence defined as a conserved hypothetical protein.

Pfam Summary:  Pfam Search
Residues 9 to 105 (E-value = 1.2e-11) place CPn0477 in the UPF0004 family which is described as Uncharacterized protein family UPF0004 (PF00919)
Residues 139 to 308 (E-value = 5.9e-29) place CPn0477 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:


Gene Protein Sequence:
MTVAEVKGTFKLVCLGCRVNQYEVQAYRDQLTILGYQEVLDSEIPADLCI
INTCAVTASAESSGRHAVRQLCRQNPTAHIVVTGCLGESDKEFFASLDRQ
CTLVSNKEKSRLIEKIFSYDTTFPEFKIHSFEGKSRAFIKVQDGCNSFCS
YCIIPYLRGRSVSRPAEKILAEIAGVVDQGYREVVIAGINVGDYCDGERS
LASLIEQVDRIPGIERIRISSIDPDDITEDLHRAITSSRHTCPSSHLVLQ
SGSNSILKRMNRKYSRGDFLDCVEKFRASDPRYAFTTDVIVGFPGESDQD
FEDTLRIIEDVGFIKVHSFPFSARRRTKAYTFDNQIPNQVIYERKKYLAE
VAKRVGQKEMMKRLGETTEVLVEKVTGQVATGHSPYFEKVSFPVVGTVAI
NTLVSVRLDRVEEEGLIGEIV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGGTTGCGGAAGTCAAAGGAACATTTAAGCTGGTCTGTTTAGGCTG
TCGGGTGAATCAGTATGAGGTCCAAGCATATCGCGACCAGTTGACTATCT
TAGGTTACCAAGAGGTCCTGGATTCTGAAATCCCTGCAGATTTATGCATA
ATCAATACGTGTGCTGTCACAGCTTCTGCTGAGAGTTCGGGTCGTCATGC
TGTGCGTCAGTTATGTCGTCAGAACCCTACAGCACATATTGTTGTCACAG
GTTGTTTGGGGGAATCTGACAAAGAGTTTTTTGCTTCTTTGGATCGGCAA
TGCACACTTGTTTCCAATAAAGAAAAATCCCGACTTATAGAAAAAATTTT
TTCCTATGATACGACCTTCCCTGAGTTCAAGATCCATAGTTTTGAGGGAA
AGTCTCGAGCTTTTATTAAAGTTCAAGATGGCTGTAATTCTTTTTGCTCG
TACTGCATTATTCCTTATTTGCGGGGGCGTTCGGTTTCTCGTCCTGCTGA
GAAGATTTTAGCTGAAATCGCAGGGGTTGTAGACCAAGGATATCGCGAAG
TTGTAATTGCAGGAATTAATGTTGGAGATTATTGCGATGGAGAGCGTTCA
TTAGCCTCTTTGATTGAACAGGTGGACCGGATTCCTGGAATTGAGAGGAT
TCGAATTTCCTCTATAGATCCTGATGATATCACTGAAGATCTGCACCGTG
CCATCACCTCATCGCGTCACACTTGTCCTTCGTCACACCTTGTTCTTCAA
TCGGGGTCGAATTCAATTTTAAAGAGAATGAACCGGAAGTATTCTCGCGG
AGATTTTTTAGATTGTGTAGAGAAGTTCCGTGCTTCTGATCCTCGCTATG
CCTTTACTACAGATGTGATTGTCGGATTTCCTGGAGAGAGTGATCAAGAT
TTTGAAGATACTTTGAGAATTATTGAAGATGTAGGCTTTATTAAAGTGCA
TAGTTTCCCTTTCAGTGCTCGTCGTCGTACTAAGGCATATACTTTTGATA
ATCAGATTCCCAATCAGGTGATCTATGAGAGGAAGAAGTATCTTGCTGAG
GTTGCTAAGAGGGTAGGCCAGAAAGAGATGATGAAGCGTTTAGGAGAGAC
TACAGAGGTGCTTGTTGAGAAAGTAACGGGGCAGGTTGCTACGGGTCACT
CTCCTTATTTTGAAAAGGTTTCTTTCCCTGTTGTAGGAACGGTAGCTATC
AACACTCTAGTTTCTGTGCGTCTTGATAGGGTAGAGGAAGAAGGGCTGAT
TGGGGAGATTGTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy