Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR382 IGR380 IGR378 IGR377 IGR381 CPn0480 CPn0477 hflX, - CPn0478 CPn0473 CPn0481 CPn0474 glgB, - CPn0475 CPn0480 CPn0477 hflX, - CPn0478 CPn0473 CPn0481 CPn0474 glgB, - CPn0475 Type: tandem, Name:  - 8 CPn0477 hflX, - CPn0478 CPn0473 CPn0481 CPn0474 glgB, - CPn0475 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476 CPn0480
* Calculated from Protein Sequence

Gene ID: CPn0476

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
554844

Gene Stop:
553855

Gene Length:
990

Molecular Weight*:
37196

pI*:
8.80

Net Charge*:
8.33

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0476 is orthologously related to CT865: residues 1-329 of CPn0476 are 48% similar to residues 1-329 of CT865, a predicted Chlamydia-specific hypothetical protein
from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MIDIMQHFKPYTMVPGQKLPIPGSLLYAQVFPTLWRLFSSKHEILNEQTL
QVQGPLKRFAVFQDLHRGGLAVTSERYKYYLLPSGECTQSIKGKLPSAAQ
AGPLLSLGVHKHADWQKVRCRRDLKEILPLWFRFAAMAPKGSYRDLETTA
IGSLVKTAHQRVLHRETTEIAPALLSIALAGFSECFLPRSYDEEFQGILP
QDGDPEGGVPFELLSYSFGMIQDIFLRHQGQLVEILPALPPEFPCGRLIH
VALPNLGTLSIVWTKKTIRQVELHAEYSGEVFLKFCSSLCSARLREWSER
RLSGSKRLSLGETLEIKAGTTYLWDCFHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGATATAATGCAACATTTTAAGCCCTATACTATGGTCCCAGGACA
AAAACTCCCTATTCCTGGATCTTTGTTATATGCTCAGGTATTTCCTACCC
TGTGGCGTCTATTTTCTTCGAAACACGAAATCTTAAATGAGCAGACCTTA
CAGGTGCAAGGGCCTTTAAAACGCTTTGCTGTTTTCCAAGATTTACATCG
TGGGGGGCTTGCAGTGACTTCTGAGCGCTACAAGTATTATCTCCTTCCCT
CGGGAGAGTGCACACAATCTATCAAAGGGAAACTGCCTTCGGCAGCGCAA
GCAGGGCCCCTGTTATCTCTTGGGGTGCATAAGCATGCAGATTGGCAAAA
GGTCCGTTGTCGTCGTGATCTTAAAGAAATTCTTCCCCTATGGTTCCGTT
TCGCCGCTATGGCTCCTAAGGGATCCTATCGGGATCTAGAGACGACGGCT
ATCGGTAGCTTGGTAAAGACTGCCCATCAAAGAGTTTTACATAGGGAAAC
TACAGAGATTGCTCCTGCGTTACTCTCCATAGCCCTTGCGGGATTTTCAG
AGTGCTTTCTTCCTAGGAGCTATGATGAAGAGTTCCAAGGAATCCTCCCC
CAAGATGGAGATCCAGAGGGGGGAGTTCCTTTTGAGCTTCTCTCGTATAG
CTTTGGTATGATCCAAGATATTTTTCTGAGACACCAGGGACAGCTAGTAG
AGATCCTTCCTGCATTACCTCCTGAATTTCCTTGTGGCCGCTTGATTCAT
GTTGCCCTTCCTAATCTTGGGACTTTGTCTATCGTCTGGACTAAGAAAAC
TATCCGTCAGGTCGAGCTCCATGCAGAATATAGTGGCGAGGTATTTTTAA
AGTTTTGTTCTTCACTATGCAGTGCGCGCCTTCGGGAATGGTCGGAGCGA
CGTCTCTCTGGATCTAAGAGACTTTCTTTAGGAGAAACTCTGGAGATAAA
AGCAGGAACCACATATTTATGGGATTGTTTTCATAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy