Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR380 IGR378 IGR376 IGR377 CPn0477 hflX, - CPn0478 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 CPn0477 hflX, - CPn0478 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 Type: tandem, Name:  - 8 CPn0477 hflX, - CPn0478 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 phnP, - CPn0479 CPn0476 phnP, - CPn0479 CPn0476
* Calculated from Protein Sequence

Gene ID: CPn0475

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
glgB  

Definition:
1,4-alpha-glucan branching enzyme

Gene Start:
553844

Gene Stop:
551682

Gene Length:
2163

Molecular Weight*:
82832

pI*:
6.20

Net Charge*:
-18.22

EC:
2.4.1.18  

Functional Class:
energy metabolism; sugars  

Pathway: pathway table
Starch and sucrose metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 1,4-alpha-glucan branching enzyme sequences; e.g. residues 11-718 are 63% similar to CT866, a predicted 1,4-alpha-glucan branching enzyme; residues 14-713 are 45% similar to GLGB_STRAU; residues 89-714 are 46% similar to GLGB_SYNP7; residues 99-716 are 50% similar to (AE000704) 1,4-alpha-glucan branching enzyme [Aquifex aeolicus]; and residues 8-696 are 44% similar to GLGB_MYCTU.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0296
COG name: 1,4-alpha-glucan branching enzyme
Functional Class:  G
The phylogenetic pattern of COG0296 is ----yq-cebRh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 135-689 span six regions of similarity to blocks BP04137A,D,F,G,H,L (ENZYME BRANCHING STARCH 4-ALPHA-GLUCAN TRANSFE) with a combined E-value of 2.4e-36.

ProDom Summary:  Protein Domain Search
Residues 347-589 are 62% similar to a defined domain of O66936_AQUAE, defined as: ENZYME BRANCHING GLYCOGEN 4-ALPHA-GLUCAN TRANSFERASE GLYCOSYLTRANSFERASE BIOSYNTHESIS PRECURSOR HYDROLASE STARCH.
Residues 102-244 are 44% similar to a defined domain of GLGB_SYNY3, defined as: ENZYME BRANCHING GLYCOGEN 4-ALPHA-GLUCAN TRANSFERASE GLYCOSYLTRANSFERASE BIOSYNTHESIS STARCH AMYLO- PRECURSOR.

Paralogs:  Local Blast Search
CPn0388 is a possible paralog: residues 169-408 are 22% similar to CPn0388.

Pfam Summary:  Pfam Search
Residues 119 to 202 (E-value = 1.1e-25) place CPn0475 in the Isoamylase_N family which is described as Isoamylase N-terminal domain (PF02922)
Residues 244 to 603 (E-value = 4.2e-06) place CPn0475 in the Alpha-amylase family which is described as Alpha amylase, catalytic domain (PF00128)

PDB Hit:


Gene Protein Sequence:
MVDKLIHPWDLDLLVSGRQKDPHKLLGILASEDSSDHIVIFRPGAHTVAI
ELLGELHHAVAYRSGLFFLSVPKGIGHGDYRVYHQNGLLAHDPYAFPPLW
GEIDSFLFHRGTHYRIYERMGAIPMEVQGISGVLFVLWAPHAQRVSVVGD
FNFWHGLVNPLRKISDQGIWELFVPGLGEGIRYKWEIVTQSGNVIVKTDP
YGKSFDPPPQGTARVADSESYSWSDHRWMERRSKQSEGPVTIYEVHLGSW
QWQEGRPLSYSEMAHRLASYCKEMHYTHVELLPITEHPLNESWGYQVTGY
YAPTSRYGTLQEFQYFVDYLHKENIGIILDWVPGHFPVDAFALASFDGEP
LYEYTGHSQALHPHWNTFTFDYSRHEVTNFLLGSALFWLDKMHIDGLRVD
AVASMLYRDYGREDGEWTPNIYGGKENLESIEFLKHLNSVIHKEFSGVLT
FAEESTAFPGVTKDVDQGGLGFDYKWNLGWMHDTFHYFMKDPMYRKYHQK
DLTFSLWYAFQESFILPLSHDEVVHGKGSLVNKLPGDTWTRFAQMRVLLS
YQICLPGKKLLFMGGEFGQYGEWSPDRPLDWELLNHHYHKTLRNCVSALN
ALYIHQPYLWMQESSQECFHWVDFHDIENNVIAYYRFAGSNRSSALLCVH
HFSASTFPSYVLRCEGVKHCELLLNTDDESFGGSGKGNRAPVVCQDQGVA
WGLDIELPPLATVIYLVTFF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGATAAACTGATCCATCCTTGGGATCTTGATCTGCTCGTCTCAGG
ACGACAGAAAGATCCCCATAAACTCTTAGGGATCCTTGCTTCTGAAGATT
CTTCAGATCATATTGTTATTTTTCGTCCAGGGGCGCATACGGTTGCTATT
GAACTTCTAGGAGAGCTTCACCACGCTGTAGCTTATCGTTCGGGGCTCTT
TTTCTTATCCGTTCCCAAAGGAATCGGACACGGGGATTACCGTGTGTATC
ATCAGAATGGACTTCTCGCTCATGATCCCTATGCGTTTCCTCCTCTGTGG
GGAGAAATTGATTCTTTTTTATTCCATAGAGGAACGCATTACCGCATTTA
TGAACGCATGGGGGCAATCCCTATGGAAGTTCAAGGAATCTCAGGGGTGC
TCTTTGTTCTTTGGGCTCCCCATGCGCAGAGAGTCTCTGTAGTCGGAGAT
TTTAATTTTTGGCATGGCCTTGTCAATCCTCTACGTAAAATTTCCGATCA
GGGGATCTGGGAGCTTTTCGTCCCAGGCTTGGGAGAGGGAATACGGTATA
AGTGGGAAATCGTTACCCAATCGGGGAATGTGATTGTAAAAACAGATCCT
TATGGGAAGAGCTTTGATCCTCCACCCCAGGGTACAGCTCGTGTTGCGGA
TTCTGAGAGCTACTCTTGGAGTGATCATCGTTGGATGGAGAGGCGCTCGA
AGCAGAGTGAAGGGCCCGTCACGATCTATGAAGTGCACTTAGGCTCTTGG
CAATGGCAGGAGGGAAGGCCCTTAAGCTACAGCGAAATGGCGCATCGCCT
TGCTAGCTATTGCAAGGAAATGCACTACACTCATGTGGAGCTTCTTCCCA
TTACGGAGCATCCCCTGAATGAATCTTGGGGCTATCAAGTGACGGGATAT
TATGCTCCAACATCAAGATACGGGACTCTCCAGGAGTTTCAGTATTTTGT
AGACTATCTACATAAAGAAAATATTGGTATTATTTTAGATTGGGTGCCGG
GACATTTTCCCGTAGATGCGTTTGCTCTTGCCTCTTTTGATGGGGAGCCT
CTCTACGAGTACACGGGGCATAGTCAGGCTCTTCATCCCCACTGGAATAC
GTTTACCTTTGACTACAGTCGTCATGAAGTGACCAACTTTTTACTAGGGA
GTGCTTTATTTTGGCTCGATAAGATGCATATTGATGGCTTACGTGTGGAT
GCTGTGGCCTCTATGCTGTATCGTGATTATGGCCGTGAAGATGGAGAATG
GACGCCTAACATCTATGGAGGTAAGGAGAACTTAGAGTCTATAGAATTTT
TGAAACACTTAAATTCTGTAATTCATAAGGAGTTCTCTGGAGTGCTCACC
TTTGCAGAGGAATCCACAGCGTTTCCAGGAGTCACTAAGGACGTAGATCA
GGGAGGTCTGGGGTTTGATTACAAATGGAACTTAGGTTGGATGCACGATA
CCTTTCATTACTTTATGAAGGATCCCATGTATCGTAAATACCATCAGAAA
GATCTGACATTTAGCCTTTGGTATGCCTTCCAAGAGTCTTTTATTCTTCC
TCTCTCGCATGACGAGGTGGTCCACGGTAAGGGCAGCTTAGTGAATAAGC
TTCCCGGGGATACCTGGACCCGATTTGCTCAAATGAGAGTGCTCTTGAGC
TACCAGATCTGTTTGCCTGGGAAAAAGTTACTGTTCATGGGTGGGGAATT
CGGACAATACGGCGAGTGGTCTCCTGATCGTCCCTTAGATTGGGAGCTTT
TGAATCATCACTACCACAAAACTTTGCGAAACTGTGTCTCTGCATTGAAT
GCGTTGTATATTCACCAACCCTATTTATGGATGCAAGAGAGCTCTCAAGA
GTGCTTCCATTGGGTAGACTTCCATGATATAGAAAACAATGTCATTGCCT
ATTATAGATTTGCAGGCAGCAATCGTTCTTCGGCGCTTCTCTGTGTCCAT
CATTTCAGTGCGAGTACTTTTCCTTCCTATGTTTTAAGGTGTGAAGGTGT
AAAGCATTGTGAACTCCTTCTCAACACTGATGATGAGTCTTTTGGAGGCT
CAGGGAAGGGAAATCGGGCTCCTGTGGTCTGTCAAGACCAAGGGGTCGCT
TGGGGTTTGGATATAGAGCTCCCTCCTTTAGCTACTGTGATCTATTTAGT
TACTTTTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy