Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR379 IGR378 IGR376 IGR377 CPn0477 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 CPn0477 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 Type: tandem, Name:  - 8 CPn0477 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 CPn0476 CPn0476
* Calculated from Protein Sequence

Gene ID: CPn0474

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
551573

Gene Stop:
549804

Gene Length:
1770

Molecular Weight*:
63007

pI*:
10.10

Net Charge*:
9.48

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0474 is similar to CT365, a predicted hypothetical protein. Residues 1-574 are 40% similar to CT365.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
404
non-globular  
472  
517

PDB Hit:


Gene Protein Sequence:
MSTSPISNDPRYLSLSNATEKTSLLANSRSLSPVPNSLVPSNPEDTGLRK
SIFTHSVTLFAGLVVLLVAVSVVVVALTVLAPGVPQAILLGIAISGVGIG
GFSIMKSLVYMVRDYMSPRMQESSRIKSALAVGTGFTVMGLVMKVGANFV
PGGYGGLVGSLGSSAYSRGSQTTLASFSHYIYTKFFRSEKVAKGEKLTEA
ETIKEAKKLHYITLSIATIGVGLAVLGILLAIAGTVLLGGAPATIAIILA
PPLISIGLTTVLQTILHSSIGKWRAFLLTQEKKDLFVDTSLKDIRLEKLP
PSEVEESETSQSVIEVPDSEGIAETRISAEEIDTRLSLTTRQKVIFALAT
LLLLASIAAFIVTGFGGLTVMQVLLVASVGSAVASVTLPMVSSGFSYVAY
QLKARLNISKLRWKEAKNKKRVRQFLIESGVIASDREFNQMWKTVYKKQI
QKTDAAIREEVRNFEKGGEVNSALVGGILLGVGTGIMLLALVPAFAPIVP
GILALGGSTLGIAGSILMRKFVNWLYDELVKLYERRRNRRELLYGPESKM
RSIATDLVVEALAASHDHLFDLDGPVDFIDVDVDIDGAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTACATCACCAATTAGCAACGATCCCCGATATTTGTCTTTGTCTAA
TGCAACTGAGAAAACTTCTCTTCTTGCAAATAGCCGGAGTCTCTCGCCAG
TACCAAATTCCCTAGTTCCTAGCAATCCTGAAGATACAGGATTGCGAAAA
AGTATTTTCACCCATTCCGTGACTTTATTTGCTGGCCTGGTTGTTTTGCT
GGTAGCGGTTTCTGTTGTTGTTGTCGCTTTGACCGTCTTAGCTCCCGGAG
TTCCTCAGGCTATTCTTCTTGGAATCGCCATTTCAGGCGTGGGTATTGGT
GGATTTTCTATAATGAAGAGCTTGGTTTATATGGTCCGAGACTATATGTC
CCCCAGGATGCAGGAGTCGAGCAGAATCAAAAGTGCTTTAGCTGTAGGGA
CTGGATTTACTGTCATGGGTTTGGTCATGAAGGTGGGGGCGAATTTTGTT
CCTGGAGGGTATGGGGGTCTCGTGGGTAGCTTGGGATCCAGTGCGTATTC
CCGGGGAAGCCAAACCACATTAGCAAGCTTCAGTCATTATATTTATACTA
AGTTTTTCCGTTCTGAAAAAGTTGCTAAAGGGGAGAAGCTTACAGAAGCA
GAAACTATAAAAGAGGCGAAAAAATTACACTATATCACGTTGTCAATTGC
CACTATTGGCGTTGGTCTTGCGGTTTTGGGGATTCTCCTTGCCATTGCAG
GAACGGTATTGCTAGGAGGCGCTCCCGCAACGATTGCTATTATTTTAGCT
CCCCCTTTAATTTCTATAGGGCTTACGACGGTTTTGCAAACGATACTCCA
TAGTAGTATCGGAAAGTGGAGAGCCTTTCTGCTTACTCAAGAAAAAAAAG
ATCTTTTTGTAGACACCTCCCTGAAAGACATTCGCTTAGAAAAATTGCCC
CCCAGTGAGGTGGAAGAGAGTGAAACTTCCCAATCTGTGATAGAAGTTCC
AGATTCAGAGGGGATTGCAGAGACGAGGATCTCTGCGGAAGAAATCGATA
CGAGGCTTTCCCTGACGACAAGACAGAAGGTCATCTTTGCTCTTGCGACA
CTCTTGCTCTTAGCAAGTATTGCTGCCTTCATAGTCACGGGATTTGGTGG
ATTGACAGTCATGCAAGTTCTCCTTGTTGCTTCTGTAGGATCGGCGGTTG
CTTCTGTAACACTCCCTATGGTTTCCTCAGGATTTTCCTACGTCGCCTAC
CAACTGAAAGCAAGATTGAATATCAGTAAATTACGTTGGAAAGAAGCAAA
AAATAAAAAGCGGGTGCGCCAGTTCTTAATTGAGTCTGGAGTGATTGCCT
CGGATCGAGAATTTAACCAAATGTGGAAGACAGTCTACAAAAAACAGATT
CAGAAGACTGACGCTGCAATTCGTGAAGAGGTTCGCAATTTTGAGAAGGG
TGGGGAAGTGAACAGCGCCCTTGTTGGTGGAATCTTACTTGGTGTAGGAA
CTGGGATCATGCTTCTTGCCCTGGTCCCTGCATTTGCTCCTATCGTTCCT
GGTATTCTTGCTCTTGGAGGATCGACGTTAGGAATCGCGGGATCGATTTT
AATGAGGAAGTTTGTCAACTGGCTCTATGATGAGCTTGTGAAGCTCTATG
AGCGTCGACGTAATCGCCGTGAGCTTCTCTATGGTCCTGAAAGTAAAATG
CGCTCCATTGCTACGGATTTAGTTGTTGAGGCTCTTGCTGCTAGCCACGA
TCATCTATTTGATCTTGATGGTCCCGTAGATTTTATTGATGTGGATGTAG
ATATAGATGGAGCTGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy