Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR378 IGR376 IGR375 IGR377 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE,pmpF, - CPn0471 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE,pmpF, - CPn0471 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE,pmpF, - CPn0471
* Calculated from Protein Sequence

Gene ID: CPn0473

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
549593

Gene Stop:
548067

Gene Length:
1527

Molecular Weight*:
53765

pI*:
5.40

Net Charge*:
-8.25

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
150  
282
coil-coil  
289  
316
non-globular  
346  
508

PDB Hit:


Gene Protein Sequence:
MAVGGVGGSRSPSPIPPNRRNSEDGKVSPKDNLGEHTVSSSDSSLASQGP
TIEERKAQLGGTDKIPLPSVKEPGDSQTSGRSGVLQRIWKGVKGVFKKTP
QARPEVSSPRLPSHVQHGQRLPGLEGFRDRIQKRSENPEADLGKMKRSYS
DGDLDRVGHDSNEDSTEDSRSEGGEPSSKSSSFLSGVRGAVSKVHGALGD
IKGKFQRSASEDDLTTQGEDSAGDTVKERRSEEAEASSKSSSFLSGVRGA
TSTVQGALGDAKEKVSAFGEQAAGAIRSAPGNIRTRFQRSSSEGDLSNVN
KAAKHLRKALENLEKVAPEQVSPEVASRVQSLLARMEQLTHQEPPTVEDL
ITFVESNVGSDSVEYASIVPQDGSQAPAETAEAPETGGVEGSAAQGAWKA
LRDFVVSIFQAVASFFRAIASRLSSARRESAVDDLASESNTQWFVEQEGV
SNPSAAPSLSFAEEIARRAAEMSNRNAQSLEKLESGNVTDPVIQQGLGLA
RSFAPEGQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGTTGGTGGCGTAGGCGGCTCAAGATCTCCTTCCCCCATTCCTCC
TAATAGAAGGAATAGTGAGGATGGAAAAGTAAGTCCTAAAGACAACTTAG
GGGAACATACAGTTAGCAGTAGTGACAGTAGTCTTGCAAGTCAGGGCCCT
ACAATAGAAGAGAGAAAAGCCCAGTTAGGCGGGACTGATAAAATTCCTTT
GCCATCTGTCAAAGAACCCGGAGATTCTCAAACTTCAGGACGTTCTGGGG
TACTTCAGAGAATTTGGAAAGGCGTTAAAGGGGTCTTTAAAAAAACCCCT
CAAGCGCGTCCTGAAGTTTCTAGTCCACGTCTTCCATCCCATGTGCAACA
TGGCCAACGTCTTCCTGGACTCGAGGGCTTTAGAGATCGTATCCAGAAAA
GATCTGAAAATCCAGAGGCAGATTTAGGGAAGATGAAACGTTCCTATTCT
GATGGTGACCTTGATCGAGTAGGACACGATTCTAATGAAGATTCTACAGA
GGATAGCCGTTCTGAAGGAGGAGAGCCTTCTTCAAAGAGTTCTTCCTTCT
TATCAGGAGTTCGAGGAGCGGTGTCTAAAGTTCATGGTGCCCTAGGTGAT
ATTAAAGGAAAGTTCCAGCGTTCTGCTTCCGAAGATGATTTAACAACTCA
GGGCGAAGATTCTGCCGGCGATACTGTAAAAGAAAGGCGTTCCGAAGAAG
CAGAGGCTTCTTCGAAGAGTTCTTCTTTTTTATCAGGAGTTCGAGGAGCG
ACGTCTACAGTTCAGGGAGCCTTAGGTGACGCTAAAGAGAAGGTTTCGGC
GTTCGGAGAGCAGGCTGCAGGTGCAATCAGATCAGCACCAGGGAATATCA
GAACTAGATTCCAACGTTCTTCATCGGAAGGTGATCTTTCTAATGTGAAT
AAAGCAGCAAAACATCTGCGTAAGGCTTTAGAAAATTTGGAAAAAGTAGC
TCCAGAACAAGTGTCACCAGAGGTGGCTTCTAGGGTGCAATCTCTTCTTG
CACGCATGGAGCAATTGACTCATCAGGAACCTCCTACTGTGGAGGATCTT
ATTACTTTCGTAGAATCCAATGTAGGTAGTGATTCTGTGGAGTATGCATC
CATCGTACCTCAAGATGGATCGCAAGCCCCAGCAGAGACTGCGGAAGCTC
CCGAAACAGGTGGGGTAGAGGGATCTGCAGCGCAGGGAGCATGGAAAGCG
TTACGGGATTTTGTAGTTAGCATATTCCAAGCGGTAGCGAGCTTCTTTAG
GGCAATTGCTTCAAGATTAAGTTCAGCACGACGTGAATCAGCTGTAGATG
ATCTTGCATCAGAAAGTAATACACAATGGTTTGTGGAGCAAGAGGGCGTT
TCAAATCCATCGGCTGCACCTAGCTTATCTTTTGCGGAAGAGATCGCTCG
TAGAGCTGCAGAAATGAGTAACAGAAATGCCCAGAGTCTTGAAAAATTGG
AATCAGGCAATGTGACTGATCCTGTCATTCAACAAGGCTTAGGATTAGCT
AGATCATTTGCTCCAGAGGGACAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy