Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR374 IGR378 IGR376 IGR375 IGR377 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE, - CPn0470 pmpE,pmpF, - CPn0471 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE, - CPn0470 pmpE,pmpF, - CPn0471 CPn0473 CPn0474 glgB, - CPn0475 CPn0472 pmpE, - CPn0470 pmpE,pmpF, - CPn0471
* Calculated from Protein Sequence

Gene ID: CPn0472

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
547905

Gene Stop:
545578

Gene Length:
2328

Molecular Weight*:
83620

pI*:
4.50

Net Charge*:
-48.26

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
250
coil-coil  
291  
322
non-globular  
347  
463
non-globular  
543  
775

PDB Hit:


Gene Protein Sequence:
MASGIGGSSGLGKIPPKDNGDRSRSPSPKGELGSHEISLPPQEHGEEGAS
GSSHIHSSSSFLPEDQESQSSSSAASSPGFFSRVRSGVDRALKSFGNFFS
AESTSQARETRQAFVRLSKTITADERRDVDSSSAAATEARVAEDASVSGE
NPSQGVPETSSGPEPQRLFSLPSVKKQSGLGRLVQTVRDRIVLPSGAPPT
DSEPLSLYELNLRLSSLRQELSDIQSNDQLTPEEKAEATVTIQQLIQITE
FQCGYMEATQSSVSLAEARFKGVETSDEINSLCSELTDPELQELMSDGDS
LQNLLDETADDLEAALSHTRLSFSLDDNPTPIDNNPTLISQEEPIYEEIG
GAADPQRTRENWSTRLWNQIREALVSLLGMILSILGSILHRLRIARHAAA
EAVGRCCTCRGEECTSSEEDSMSVGSPSEIDETERTGSPHDVPRRNGSPR
EDSPLMNALVGWAHKHGAKTKESSESSTPEISISAPIVRGWSQDSSVSFI
VMEDDHIFYDVPRRKDGIYDVPSSPRWSPARELEEDVFGDYEVPITSAEP
SKDKNIYMTPRLATPAIYDLPSRPGSSGSSRSPSSDRVRSSSPNRRGVPL
PPVPSPAMSEEGSIYEDMSGASGAGESDYEDMSRSPSPRGDLDEPIYANT
PEDNPFTQRNIDRILQERSGGASASPVEPIYDEIPWIHGRPPATLPRPEN
TLTNVSLRVSPGFGPEVRAALLSESVSAVMVEAESIVPPTEPGDGESEYL
EPLGGLVATTKILLQKGWPRGESNA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATCAGGAATCGGAGGATCTAGTGGATTAGGAAAGATTCCACCTAA
AGATAATGGGGATAGAAGTCGATCGCCCTCTCCTAAGGGAGAACTTGGCA
GCCACGAGATTTCCCTGCCTCCTCAAGAACATGGAGAGGAAGGAGCTTCA
GGATCTTCGCATATACATAGCAGTTCCTCTTTTCTACCAGAAGATCAGGA
GTCTCAGAGCTCTTCTTCGGCAGCTTCTAGCCCGGGATTTTTTTCTCGCG
TACGTTCTGGGGTAGACAGGGCCTTAAAATCATTTGGCAACTTTTTTTCC
GCAGAGTCTACGAGTCAAGCGCGTGAAACGCGACAAGCTTTTGTTAGATT
ATCAAAAACCATCACCGCGGATGAGAGACGGGATGTCGATTCATCAAGTG
CTGCTGCTACAGAAGCCCGAGTGGCAGAGGACGCGAGTGTTTCAGGCGAA
AATCCTTCTCAGGGGGTTCCAGAAACCTCTTCTGGACCAGAACCTCAGCG
TTTATTTTCTCTTCCTTCAGTAAAAAAACAGAGCGGTTTGGGTCGGTTGG
TACAGACAGTTCGCGATCGCATAGTACTTCCTAGTGGGGCTCCACCTACA
GACAGCGAGCCTTTAAGTCTCTACGAGCTAAACCTCCGTTTGAGTAGTTT
ACGTCAGGAGCTCTCTGACATACAAAGTAATGATCAGTTGACTCCAGAGG
AAAAAGCAGAAGCCACAGTTACCATACAACAGCTGATCCAAATTACAGAA
TTCCAATGCGGCTATATGGAGGCAACACAATCTTCGGTATCTCTAGCAGA
AGCTCGTTTTAAGGGGGTAGAAACTAGTGATGAGATCAATTCCCTCTGTT
CAGAACTGACAGATCCTGAGCTTCAAGAACTCATGAGTGATGGAGACTCT
CTTCAAAACCTATTAGATGAGACTGCCGACGATTTAGAAGCTGCTTTGTC
CCATACTCGATTGAGTTTTTCTTTAGACGATAATCCAACTCCGATAGACA
ATAATCCAACTCTGATTTCTCAAGAAGAGCCTATTTATGAGGAAATCGGA
GGAGCTGCAGATCCTCAAAGAACTCGGGAAAACTGGTCTACAAGATTATG
GAATCAGATTCGCGAGGCTCTGGTTTCTCTTTTAGGAATGATTTTAAGCA
TTCTAGGGTCCATCTTGCACAGGTTGCGTATTGCTCGTCATGCAGCTGCT
GAAGCAGTGGGTCGTTGTTGCACGTGCCGAGGAGAAGAGTGTACTTCTTC
TGAAGAGGACTCGATGTCGGTGGGGTCTCCTTCAGAAATTGATGAAACTG
AAAGAACGGGCTCTCCGCATGACGTTCCACGCAGAAATGGAAGTCCACGT
GAAGATTCTCCATTGATGAATGCCTTAGTAGGATGGGCACATAAGCACGG
TGCTAAAACCAAGGAGAGTTCAGAATCAAGTACCCCGGAAATTTCGATTT
CTGCTCCCATAGTGAGAGGTTGGAGTCAAGACAGTTCCGTCAGTTTTATT
GTTATGGAAGATGATCATATTTTCTATGATGTTCCTCGTAGAAAAGATGG
AATCTATGACGTTCCTAGTTCCCCTAGATGGAGTCCTGCGCGAGAGTTGG
AAGAGGATGTTTTTGGAGATTATGAAGTTCCTATAACCTCTGCTGAACCA
TCTAAAGACAAGAACATCTACATGACACCTAGATTAGCAACTCCTGCTAT
CTATGATCTTCCTTCACGTCCAGGATCGTCTGGAAGCTCACGTTCTCCGT
CTTCAGATCGCGTACGAAGCAGCTCACCAAATAGACGGGGTGTGCCTCTT
CCTCCAGTTCCTTCACCTGCTATGAGTGAGGAGGGGAGCATTTATGAGGA
TATGAGCGGTGCTTCAGGTGCAGGTGAAAGTGATTATGAAGATATGAGCC
GTTCCCCCTCTCCTAGAGGCGACTTGGATGAACCCATATATGCTAATACT
CCTGAAGATAATCCATTTACTCAGAGAAATATAGATAGAATTTTACAGGA
GAGGTCAGGCGGTGCTTCCGCTTCTCCTGTAGAGCCTATTTATGATGAGA
TCCCATGGATTCATGGCAGGCCCCCTGCTACACTTCCAAGACCCGAGAAT
ACATTGACTAATGTTTCGCTTAGAGTGAGCCCAGGGTTTGGACCAGAAGT
AAGAGCCGCTTTGCTTAGCGAGAGCGTGAGTGCTGTTATGGTCGAAGCAG
AGAGTATTGTTCCTCCAACAGAGCCGGGGGACGGAGAATCAGAATATCTA
GAGCCCTTAGGGGGACTTGTAGCTACAACGAAAATCTTACTACAAAAAGG
ATGGCCTCGTGGAGAGTCGAATGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy