Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR374 IGR376 IGR375 IGR373 CPn0473 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471 CPn0473 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471 CPn0473 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471
* Calculated from Protein Sequence

Gene ID: CPn0471

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpE  pmpF  

Definition:
outer membrane protein E/F

Gene Start:
542564

Gene Stop:
545404

Gene Length:
2841

Molecular Weight*:
103619

pI*:
6.60

Net Charge*:
-5.32

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0471 is similar to CT869, CT870, CT874, CT871, CT872, CT412, CT812, CT413, and CT414, all predicted outer membrane proteins. Residues 77-946 are 28% similar to CT869, a predicted pmpE outer membrane protein E. No significant similarities to M. genitalium, T. pallidum or U. urealyticum sequences.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0471 is similar to sixteen other outer membrane proteins, namely, CPn0470, CPn0466, CPn0467, CPn0454, CPn0444, CPn0446, CPn0453, CPn0447, CPn0451, CPn0445, CPn0539, CPn0005, CPn0540, CPn0013, CPn0963, CPn0452.

Pfam Summary:  Pfam Search
Residues 45 to 438 (E-value = 3.3e-06) place CPn0471 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)
Residues 661 to 946 (E-value = 7.2e-32) place CPn0471 in the Autotransporter family which is described as Autotransporter beta-domain (PF03797)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
138  
247
non-globular  
472  
592
non-globular  
672  
802

PDB Hit:


Gene Protein Sequence:
VQNNRSLSKSSFFVGALILGKTTILLNATPLSDYFDNQANQLTTLFPLID
TLTNMTPYSHRATLFGVRDDTNQDIVLDHQNSIESWFENFSQDGGALSCK
SLAITNTKNQILFLNSFAIKRAGAMYVNGNFDLSENHGSIIFSGNLSFPN
ASNFADTCTGGAVLCSKNVTISKNQGTAYFINNKAKSSGGAIQAAIINIK
DNTGPCLFFNNAAGGTAGGALFANACRIENNSQPIYFLNNQSGLGGAIRV
HQECILTKNTGSVIFNNNFAMEADISANHSSGGAIYCISCSIKDNPGIAA
FDNNTAARDGGAICTQSLTIQDSGPVYFTNNQGTWGGAIMLRQDGACTLF
ADQGDIIFYNNRHFKDTFSNHVSVNCTRNVSLTVGASQGHSATFYDPILQ
RYTIQNSIQKFNPNPEHLGTILFSSTYIPDTSTSRDDFISHFRNHIGLYN
GTLALEDRAEWKVYKFDQFGGTLRLGSRAVFSTTDEEQSSSSVGSVININ
NLAINLPSILGNRVAPKLWIRPTGSSAPYSEDNNPIINLSGPLSLLDDEN
LDPYDTADLAQPIAEVPLLYLLDVTAKHINTDNFYPEGLNTTQHYGYQGV
WSPYWIETITTSDTSSEDTVNTLHRQLYGDWTPTGYKVNPENKGDIALSA
FWQSFHNLFATLRYQTQQGQIAPTASGEATRLFVHQNSNNDAKGFHMEAT
GYSLGTTSNTASNHSFGVNFSQLFSNLYESHSDNSVASHTTTVALQINNP
WLQERFSTSASLAYSYSNHHIKASGYSGKIQTEGKCYSTTLGAALSCSLS
LQWRSRPLHFTPFIQAIAVRSNQTAFQESGDKARKFSVHKPLYNLTVPLG
IQSAWESKFRLPTYWNIELAYQPVLYQQNPEINVSLESSGSSWLLSGTTL
ARNAIAFKGRNQIFIFPKLSVFLDYQGSVSSSTTTHYLHAGTTFKF$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAAAATAACAGATCCCTTAGTAAATCTTCCTTCTTTGTTGGAGCCTT
AATTTTAGGTAAAACTACAATACTCCTTAATGCGACTCCGTTGTCTGACT
ATTTTGATAATCAAGCAAATCAACTCACAACACTCTTCCCTCTAATTGAT
ACTCTTACTAACATGACTCCCTACTCTCATAGAGCAACACTTTTTGGAGT
TAGGGATGACACTAACCAAGACATTGTCCTCGATCACCAGAATTCCATAG
AAAGCTGGTTCGAAAACTTCTCTCAAGACGGCGGTGCTCTCTCTTGCAAA
TCACTTGCCATAACGAATACAAAAAACCAAATTCTTTTCCTAAATAGCTT
TGCTATTAAAAGAGCTGGTGCGATGTATGTGAATGGTAATTTCGATCTTT
CTGAGAATCATGGTTCCATCATTTTCTCTGGGAATTTAAGCTTTCCTAAT
GCAAGTAATTTCGCTGATACTTGTACAGGGGGAGCTGTTTTATGTTCGAA
AAATGTTACAATCTCAAAAAATCAAGGAACCGCATACTTCATTAACAACA
AGGCAAAATCTTCAGGAGGAGCAATCCAAGCTGCAATCATAAACATTAAG
GACAACACTGGCCCTTGCCTGTTTTTTAATAATGCTGCAGGCGGAACAGC
GGGGGGCGCGTTGTTCGCTAATGCTTGTAGAATTGAGAATAATTCTCAGC
CTATCTATTTTTTGAATAACCAATCAGGTCTGGGTGGTGCAATAAGAGTA
CATCAAGAGTGCATTCTTACAAAGAATACCGGTTCTGTGATCTTCAACAA
TAATTTTGCCATGGAAGCGGACATCTCTGCTAACCATTCCTCTGGAGGGG
CTATCTATTGCATTAGTTGTTCTATAAAAGACAACCCAGGAATTGCAGCC
TTCGATAATAATACTGCAGCACGAGATGGAGGTGCTATCTGTACACAATC
TCTAACTATACAAGACAGTGGTCCCGTCTATTTCACAAACAATCAGGGAA
CTTGGGGCGGCGCTATCATGCTCCGTCAAGATGGTGCATGCACTTTATTT
GCTGATCAGGGAGATATTATTTTTTATAATAATAGACACTTCAAAGATAC
TTTCAGCAATCATGTTTCTGTAAACTGCACGCGTAATGTCTCATTAACAG
TTGGAGCAAGTCAAGGTCATTCTGCTACCTTCTATGATCCCATACTACAA
AGATATACTATACAAAACTCTATCCAAAAATTTAATCCTAATCCAGAACA
CCTCGGAACTATCTTGTTCTCCTCAACATATATTCCGGATACATCGACTT
CTCGTGATGACTTCATTTCACATTTCAGAAACCACATTGGACTGTACAAC
GGCACACTCGCTCTTGAAGATCGAGCAGAGTGGAAAGTCTATAAATTTGA
TCAATTTGGTGGGACTCTACGGTTAGGCAGTAGAGCTGTGTTTTCTACAA
CAGACGAAGAACAAAGTAGCAGTAGTGTGGGTTCTGTAATTAACATCAAT
AATCTTGCAATTAACCTTCCCTCTATCTTAGGCAACAGAGTTGCTCCCAA
GCTATGGATTCGCCCCACAGGTTCATCAGCACCCTATAGCGAAGATAATA
ACCCTATAATCAATCTCTCAGGACCTTTGAGCCTACTGGATGACGAGAAC
CTAGATCCCTATGATACTGCAGACCTTGCCCAACCTATCGCAGAAGTTCC
TCTTCTGTATCTCTTAGACGTCACAGCTAAACATATTAATACGGATAATT
TCTACCCTGAGGGTCTAAATACAACTCAACACTACGGCTACCAAGGCGTT
TGGTCCCCTTACTGGATCGAAACAATCACAACTTCTGATACCTCTTCTGA
AGATACTGTGAATACTTTACATCGCCAGCTTTATGGTGATTGGACACCTA
CAGGATATAAGGTAAACCCAGAAAACAAAGGAGACATTGCCCTATCTGCC
TTCTGGCAATCTTTCCATAACTTATTTGCGACACTACGTTATCAAACACA
GCAAGGCCAAATAGCACCTACAGCTTCTGGAGAAGCTACTCGACTCTTCG
TGCATCAAAATAGCAACAATGATGCGAAAGGATTCCATATGGAAGCTACG
GGTTATTCTTTGGGAACAACCTCAAACACTGCTTCTAATCATAGCTTTGG
TGTAAACTTCTCCCAACTTTTCAGTAATCTCTACGAGAGCCACTCCGACA
ATTCCGTGGCTTCGCATACGACAACTGTAGCGCTCCAGATCAATAATCCT
TGGCTGCAAGAGAGATTCTCTACATCTGCATCTCTAGCCTACAGCTACAG
CAACCACCATATCAAAGCATCTGGATATTCTGGAAAAATACAAACGGAAG
GCAAATGTTATAGTACGACATTAGGGGCGGCTCTCTCTTGCTCTCTATCT
CTACAATGGCGATCACGACCTCTCCACTTCACTCCTTTTATCCAAGCAAT
TGCCGTTCGTTCTAATCAAACTGCGTTTCAAGAAAGTGGAGATAAAGCTA
GAAAATTTTCTGTTCATAAACCCTTATATAACCTGACAGTCCCTCTGGGA
ATTCAGAGCGCTTGGGAATCCAAGTTCCGTCTTCCTACCTATTGGAACAT
AGAGCTTGCTTATCAGCCTGTCCTCTACCAACAAAATCCTGAGATCAACG
TGAGTCTAGAATCTAGTGGATCGTCATGGCTCCTATCAGGAACCACCCTT
GCTCGCAATGCCATTGCTTTTAAAGGAAGAAACCAAATTTTTATCTTCCC
TAAACTTTCGGTGTTCTTAGACTATCAAGGCTCGGTATCCTCATCAACGA
CGACACATTACCTTCACGCAGGAACGACCTTTAAGTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy