Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR374 IGR375 IGR373 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471 CPn0472 pmpE, - CPn0470 CPn0467 pmpE,pmpF, - CPn0471
* Calculated from Protein Sequence

Gene ID: CPn0470

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpE  

Definition:
outer membrane protein E

Gene Start:
541357

Gene Stop:
542535

Gene Length:
1179

Molecular Weight*:
44335

pI*:
9.20

Net Charge*:
9.14

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0470 is similar to CT869, CT870, CT871, CT872, CT412, and CT812, all predicted outer membrane proteins. Residues 10-387 are 32% similar to CT869, a predicted pmpE outer membrane protein E. No significant similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0470 is similar to sixteen other outer membrane proteins, namely, CPn0471, CPn0466, CPn0467, CPn0454, CPn0444, CPn0446, CPn0453, CPn0447, CPn0451, CPn0445, CPn0539, CPn0005, CPn0540, CPn0013, CPn0963, CPn0452.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
ISLNLERISPLLYLLDVTAKKIDTSNLIVEAMNLDEHYGYQGIWSPYWME
TTTTTSSTVPEQTNTNHRQLYVDWTPVGYRPNPERHGEFIANTLWQSAYN
ALLGIRILPPQNLKEHDLEASLQGLGLLINQHNREGRKGFRNHTTGYAAT
TSAKTAARHSFSLGFAQMFSKTRERQSPSTTSSHNYFAGLRFDSLLFRDF
ISTGLSLGYSYGDHHMLCHYTEILKGSSKAFFNNHTLVASLDCTFLPARI
TRTLELQPFISAIALRCSQASFQETGDHIRKFHPKHPLTDLSSPIGFRSE
WKTSHHIPMLWTTEISYVPTLYRKNPEMFTTLLISNGTWTTQATPVSYNS
VAAKIKNTSQLFSRVTLSLDYSAQVSSSTVGQYLKAESHCTF$

Gene Nucleotide Sequence:  Sequence Viewer
ATCTCTCTGAACCTCGAAAGGATATCCCCCCTCCTCTACCTCCTCGATGT
GACTGCAAAAAAAATCGATACTTCGAATCTCATTGTAGAAGCCATGAACT
TAGATGAGCACTATGGATATCAGGGAATCTGGTCTCCCTATTGGATGGAA
ACTACGACTACAACAAGCTCTACAGTACCGGAACAGACCAATACAAACCA
CAGGCAGCTCTACGTAGACTGGACTCCTGTAGGATACCGCCCTAACCCGG
AACGTCACGGAGAATTTATTGCTAATACCTTATGGCAGTCTGCCTATAAC
GCTCTGTTAGGAATCCGCATCTTACCTCCACAAAACCTCAAAGAGCATGA
CCTTGAAGCCTCTCTGCAAGGACTCGGGCTTCTAATTAACCAACATAATC
GCGAGGGACGCAAAGGCTTCCGAAACCATACTACGGGCTATGCAGCAACA
ACCTCAGCAAAAACTGCAGCACGACATAGTTTCTCTTTAGGATTCGCACA
AATGTTCTCCAAAACTAGAGAACGTCAATCTCCAAGTACGACTTCCTCCC
ACAACTACTTTGCAGGACTCCGCTTCGACAGTCTCCTCTTCAGGGACTTC
ATCTCTACAGGGCTATCCCTAGGTTATAGCTACGGAGATCACCATATGCT
TTGCCACTATACAGAAATCTTAAAAGGGTCGTCCAAAGCCTTCTTTAATA
ACCACACTTTGGTAGCCTCTCTAGACTGCACATTCTTACCAGCTAGAATC
ACCCGCACTCTCGAACTCCAGCCCTTTATCAGTGCCATTGCTCTGCGCTG
TTCCCAGGCCTCGTTCCAAGAAACTGGAGACCATATAAGAAAATTCCATC
CAAAACATCCCCTTACAGATCTTTCCTCTCCCATAGGCTTCCGTTCTGAA
TGGAAAACTTCACATCATATCCCCATGCTATGGACTACGGAAATATCCTA
CGTACCTACCCTATACAGAAAAAATCCAGAAATGTTCACGACACTACTCA
TCAGCAATGGAACATGGACAACACAAGCAACTCCCGTCTCCTATAATTCC
GTAGCTGCAAAAATAAAAAATACTTCCCAACTTTTCTCAAGAGTAACCTT
ATCCTTAGATTATTCAGCTCAAGTCTCCTCGTCAACTGTAGGTCAATACC
TTAAAGCTGAGAGTCATTGCACATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy