Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR374 IGR372 IGR371 IGR373 CPn0465 pmpE, - CPn0470 CPn0467 pmpE, - CPn0466 pmpE,pmpF, - CPn0471 CPn0465 pmpE, - CPn0470 CPn0467 pmpE, - CPn0466 pmpE,pmpF, - CPn0471 CPn0465 pmpE, - CPn0470 CPn0467 pmpE, - CPn0466 pmpE,pmpF, - CPn0471
* Calculated from Protein Sequence

Gene ID: CPn0467

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
outer membrane protein E

Gene Start:
536633

Gene Stop:
539437

Gene Length:
2805

Molecular Weight*:
102145

pI*:
6.50

Net Charge*:
-8.31

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0467 is similar to CT869, CT870, CT871, CT874, CT412, CT872, CT413, and CT414, all predicted outer membrane proteins. Residues 48-934 are 31% similar to CT869, a predicted pmpE outer membrane protein E. No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0467 is similar to sixteen other outer membrane proteins, namely, CPn0471, CPn0466, CPn0470, CPn0454, CPn0444, CPn0446, CPn0453, CPn0447, CPn0451, CPn0445, CPn0539, CPn0005, CPn0540, CPn0013, CPn0963, CPn0452.

Pfam Summary:  Pfam Search
Residues 15 to 418 (E-value = 7.6e-06) place CPn0467 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)
Residues 649 to 934 (E-value = 8.7e-31) place CPn0467 in the Autotransporter family which is described as Autotransporter beta-domain (PF03797)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
191  
308

PDB Hit:


Gene Protein Sequence:
MFGMTPAVYSLQTDSLEKFALERDEEFRTSFPLLDSLSTLTGFSPITTFV
GNRHNSSQDIVLSNYKSIDNILLLWTSAGGAVSCNNFLLSNVEDHAFFSK
NLAIGTGGAIACQGACTITKNRGPLIFFSNRGLNNASTGGETRGGAIACN
GDFTISQNQGTFYFVNNSVNNWGGALSTNGHCRIQSNRAPLLFFNNTAPS
GGGALRSENTTISDNTRPIYFKNNCGNNGGAIQTSVTVAIKNNSGSVIFN
NNTALSGSINSGNGSGGAIYTTNLSIDDNPGTILFNNNYCIRDGGAICTQ
FLTIKNSGHVYFTNNQGNWGGALMLLQDSTCLLFAEQGNIAFQNNEVFLT
TFGRYNAIHCTPNSNLQLGANKGYTTAFFDPIEHQHPTTNPLIFNPNANH
QGTILFSSAYIPEASDYENNFISSSKNTSELRNGVLSIEDRAGWQFYKFT
QKGGILKLGHAASIATTANSETPSTSVGSQVIINNLAINLPSILAKGKAP
TLWIRPLQSSAPFTEDNNPTITLSGPLTLLNEENRDPYDSIDLSEPLQNI
HLLSLSDVTARHINTDNFHPESLNATEHYGYQGIWSPYWVETITTTNNAS
IETANTLYRALYANWTPLGYKVNPEYQGDLATTPLWQSFHTMFSLLRSYN
RTGDSDIERPFLEIQGIADGLFVHQNSIPGAPGFRIQSTGYSLQASSETS
LHQKISLGFAQFFTRTKEIGSSNNVSAHNTVSSLYVELPWFQEAFATSTV
LAYGYGDHHLHSLHPSHQEQAEGTCYSHTLAAAIGCSFPWQQKSYLHLSP
FVQAIAIRSHQTAFEEIGDNPRKFVSQKPFYNLTLPLGIQGKWQSKFHVP
TEWTLELSYQPVLYQQNPQIGVTLLASGGSWDILGHNYVRNALGYKVHNQ
TALFRSLDLFLDYQGSVSSSTSTHHLQAGSTLKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCGGGATGACTCCTGCAGTGTATAGTTTACAAACGGACTCCCTTGA
AAAGTTTGCTTTAGAGAGGGATGAAGAGTTTCGTACGAGCTTTCCTCTCT
TAGACTCTCTCTCCACTCTTACAGGATTTTCTCCAATAACTACGTTTGTT
GGAAATAGACATAATTCCTCTCAAGACATTGTACTTTCTAACTACAAGTC
TATTGATAACATCCTTCTTCTTTGGACATCGGCTGGGGGAGCTGTGTCCT
GTAATAATTTCTTATTATCAAATGTTGAAGACCATGCCTTCTTCAGTAAA
AATCTCGCGATTGGGACTGGAGGCGCGATTGCTTGCCAGGGAGCCTGCAC
AATCACGAAGAATAGAGGACCCCTTATTTTTTTCAGCAATCGAGGTCTTA
ACAATGCGAGTACAGGAGGAGAAACTCGTGGGGGTGCGATTGCCTGTAAT
GGAGACTTCACGATTTCTCAAAATCAAGGGACTTTCTACTTTGTCAACAA
TTCCGTCAACAACTGGGGAGGAGCCCTCTCCACCAATGGACACTGCCGCA
TCCAAAGCAACAGGGCACCTCTACTCTTTTTTAACAATACAGCCCCTAGT
GGAGGGGGTGCGCTTCGTAGTGAAAATACAACGATCTCTGATAACACGCG
TCCTATTTATTTTAAGAACAACTGTGGGAACAATGGCGGGGCCATTCAAA
CAAGCGTTACTGTTGCGATAAAAAATAACTCCGGGTCGGTGATTTTCAAT
AACAACACAGCGTTATCTGGTTCGATAAATTCAGGAAATGGTTCAGGAGG
GGCGATTTATACAACAAACCTATCCATAGACGATAACCCTGGAACTATTC
TTTTCAATAATAACTACTGCATTCGCGATGGCGGAGCTATCTGTACACAA
TTTTTGACAATCAAAAATAGTGGCCACGTATATTTCACCAACAATCAAGG
AAACTGGGGAGGTGCTCTTATGCTCCTACAGGACAGCACCTGCCTACTCT
TCGCGGAACAAGGAAATATCGCATTTCAAAATAATGAGGTTTTCCTCACC
ACATTTGGTAGATACAACGCCATACATTGTACACCAAATAGCAACTTACA
ACTTGGAGCTAATAAGGGGTATACGACTGCTTTTTTTGATCCTATAGAAC
ACCAACATCCAACTACAAATCCTCTAATCTTTAATCCCAATGCGAACCAT
CAGGGAACGATCTTATTTTCTTCAGCCTATATCCCAGAAGCTTCTGACTA
CGAAAATAATTTCATTAGCAGCTCGAAAAATACCTCTGAACTTCGCAATG
GTGTCCTCTCTATCGAGGATCGTGCGGGATGGCAATTCTATAAGTTCACT
CAAAAAGGAGGTATCCTTAAATTAGGGCATGCGGCGAGTATTGCAACAAC
TGCCAACTCTGAGACTCCATCAACTAGTGTAGGCTCCCAGGTCATCATTA
ATAACCTTGCGATTAACCTCCCCTCGATCTTAGCAAAAGGAAAAGCTCCT
ACCTTGTGGATCCGTCCTCTACAATCTAGTGCTCCTTTCACAGAGGACAA
TAACCCTACAATTACTTTATCAGGTCCTCTGACACTCTTAAATGAGGAAA
ACCGCGATCCCTACGACAGTATAGATCTCTCTGAGCCTTTACAAAACATT
CATCTTCTTTCTTTATCGGATGTAACAGCACGTCATATCAATACCGATAA
CTTTCATCCTGAAAGCTTAAATGCGACTGAGCATTACGGTTATCAAGGCA
TCTGGTCTCCTTATTGGGTAGAGACGATAACAACAACAAATAACGCTTCT
ATAGAGACGGCAAACACCCTCTACAGAGCTCTGTATGCCAATTGGACTCC
CTTAGGATATAAGGTCAATCCTGAATACCAAGGAGATCTTGCTACGACTC
CCCTATGGCAATCCTTTCATACTATGTTCTCTCTATTAAGAAGTTATAAT
CGAACTGGTGATTCTGATATCGAGAGGCCTTTCTTAGAAATTCAAGGGAT
TGCCGACGGCCTCTTTGTTCATCAAAATAGCATCCCCGGGGCTCCAGGAT
TCCGTATCCAATCTACAGGGTATTCCTTACAAGCATCCTCCGAAACTTCT
TTACATCAGAAAATCTCCTTAGGTTTTGCACAGTTCTTCACCCGCACTAA
AGAAATCGGATCAAGCAACAACGTCTCGGCTCACAATACAGTCTCTTCAC
TTTATGTTGAGCTTCCGTGGTTCCAAGAGGCCTTTGCAACATCCACAGTG
TTAGCGTATGGCTATGGGGACCATCACCTCCACAGCCTACATCCCTCACA
TCAAGAACAGGCAGAAGGGACGTGTTATAGCCATACATTAGCAGCAGCTA
TCGGCTGTTCTTTCCCTTGGCAACAGAAATCCTATCTTCACCTCAGCCCG
TTCGTTCAGGCAATTGCAATACGTTCTCACCAAACAGCGTTCGAAGAGAT
TGGTGACAATCCCCGAAAGTTTGTCTCTCAAAAGCCTTTCTATAATCTGA
CCTTACCTCTAGGAATCCAAGGAAAATGGCAGTCAAAATTCCACGTACCT
ACAGAATGGACTCTAGAACTTTCTTACCAACCGGTACTCTATCAACAAAA
TCCCCAAATCGGTGTCACGCTACTTGCGAGCGGAGGTTCCTGGGATATCC
TAGGCCATAACTATGTTCGCAATGCTTTAGGGTACAAAGTCCACAATCAA
ACTGCGCTCTTCCGTTCTCTCGATCTATTCTTGGATTACCAAGGATCGGT
CTCCTCCTCGACATCTACGCACCATCTCCAAGCAGGAAGTACCTTAAAAT
TCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy