Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR372 IGR368 IGR371 IGR373 CPn0465 CPn0464 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0465 CPn0464 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0464 CPn0463 CPn0462 CPn0465 CPn0467 pmpE, - CPn0466
* Calculated from Protein Sequence

Gene ID: CPn0466

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpE  

Definition:
outer membrane protein E

Gene Start:
533724

Gene Stop:
536540

Gene Length:
2817

Molecular Weight*:
102190

pI*:
7.00

Net Charge*:
0.31

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0466 is similar to CT869, CT870, CT871, CT872, CT874, CT412, CT812, and CT413, all predicted outer membrane proteins. Residues 88-938 are 31% similar to CT869, a predicted pmpE outer membrane protein E.No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0466 is similar to sixteen other outer membrane proteins, namely, CPn0467, CPn0446,CPn0444, CPn0454, CPn0453, CPn0471, CPn0445, CPn0539, CPn0447, CPn0451, CPn0005, CPn0013, CPn0540, CPn0963, CPn0470, CPn0452.

Pfam Summary:  Pfam Search
Residues 1 to 420 (E-value = 1.1e-05) place CPn0466 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17
non-globular  
92  
370
non-globular  
456  
520
non-globular  
676  
735

PDB Hit:


Gene Protein Sequence:
MRFFCFGMLLPFTFVLANEGLQLPLETYITLSPEYQAAPQVGFTHNQNQD
LAIVGNHNDFILDYKYYRSNGGALTCKNLLISENIGNVFFEKNVCPNSGG
AIYAAQNCTISKNQNYAFTTNLVSDNPTATAGSLLGGALFAINCSITNNL
GQGTFVDNLALNKGGALYTETNLSIKDNKGPIIIKQNRALNSDSLGGGIY
SGNSLNIEGNSGAIQITSNSSGSGGGIFSTQTLTISSNKKLIEISENSAF
ANNYGSNFNPGGGGLTTTFCTILNNREGVLFNNNQSQSNGGAIHAKSIII
KENGPVYFLNNTATRGGALLNLSAGSGNGSFILSADNGDIIFNNNTASKH
ALNPPYRNAIHSTPNMNLQIGARPGYRVLFYDPIEHELPSSFPILFNFET
GHTGTVLFSGEHVHQNFTDEMNFFSYLRNTSELRQGVLAVEDGAGLACYK
FFQRGGTLLLGQGAVITTAGTIPTPSSTPTTVGSTITLNHIAIDLPSILS
FQAQAPKIWIYPTKTGSTYTEDSNPTITISGTLTLRNSNNEDPYDSLDLS
HSLEKVPLLYIVDVAAQKINSSQLDLSTLNSGEHYGYQGIWSTYWVETTT
ITNPTSLLGANTKHKLLYANWSPLGYRPHPERRGEFITNALWQSAYTALA
GLHSLSSWDEEKGHAASLQGIGLLVHQKDKNGFKGFRSHMTGYSATTEAT
SSQSPNFSLGFAQFFSKAKEHESQNSTSSHHYFSGMCIENTLFKEWIRLS
VSLAYMFTSEHTHTMYQGLLEGNSQGSFHNHTLAGALSCVFLPQPHGESL
QIYPFITALAIRGNLAAFQESGDHAREFSLHRPLTDVSLPVGIRASWKNH
HRVPLVWLTEISYRSTLYRQDPELHSKLLISQGTWTTQATPVTYNALGIK
VKNTMQVFPKVTLSLDYSADISSSTLSHYLNVASRMRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCTTTTTTTGCTTCGGAATGTTGCTTCCTTTTACTTTTGTATTGGC
TAATGAAGGTCTCCAACTTCCTTTGGAGACCTATATTACATTAAGTCCTG
AATATCAAGCAGCCCCTCAAGTAGGGTTTACTCATAACCAAAATCAAGAT
CTCGCAATTGTCGGGAATCACAATGATTTCATCTTGGACTATAAGTACTA
TCGGTCGAATGGAGGTGCTCTTACCTGTAAGAATCTTCTGATCTCTGAAA
ATATAGGGAATGTCTTCTTTGAGAAGAATGTCTGTCCCAATTCTGGCGGG
GCAATTTATGCTGCTCAAAATTGCACGATCTCCAAGAATCAGAACTATGC
ATTTACTACAAACTTGGTCTCTGACAATCCTACAGCCACTGCGGGATCAC
TATTGGGTGGAGCTCTCTTTGCCATAAATTGCTCTATTACTAATAACCTA
GGACAGGGAACTTTCGTTGACAATCTCGCTTTAAATAAGGGGGGTGCCCT
CTATACTGAGACGAACTTATCTATTAAAGACAATAAAGGCCCGATCATAA
TCAAGCAGAATCGGGCACTAAATTCGGACAGTTTAGGAGGAGGGATTTAT
AGTGGGAACTCTCTAAATATAGAGGGAAATTCTGGAGCTATACAGATCAC
AAGCAACTCTTCAGGATCTGGGGGAGGCATATTTTCTACCCAAACACTCA
CGATCTCCTCGAATAAAAAACTCATAGAAATCAGTGAAAATTCCGCGTTC
GCAAATAACTATGGATCGAACTTCAATCCAGGAGGAGGAGGTCTTACTAC
CACCTTTTGCACGATATTGAACAACCGAGAAGGGGTACTCTTTAACAATA
ACCAAAGCCAGAGCAACGGTGGAGCCATTCATGCGAAATCTATCATTATC
AAAGAAAATGGTCCTGTATACTTTTTAAATAACACTGCAACTCGGGGAGG
GGCTCTCCTCAACTTATCAGCAGGTTCTGGAAACGGAAGCTTCATCTTAT
CTGCAGATAATGGAGATATTATCTTTAACAATAATACGGCCTCCAAGCAT
GCCCTCAATCCTCCATACAGAAACGCCATTCACTCGACTCCTAATATGAA
TCTGCAAATAGGAGCCCGTCCCGGCTATCGAGTGCTGTTCTATGATCCCA
TAGAACATGAGCTCCCTTCCTCCTTCCCCATACTCTTTAATTTCGAAACC
GGTCATACAGGTACAGTTTTATTTTCAGGGGAACATGTACACCAGAACTT
TACCGATGAAATGAATTTCTTTTCCTATTTAAGGAACACTTCGGAACTAC
GTCAAGGAGTCCTTGCTGTTGAAGATGGTGCGGGGCTGGCCTGCTATAAG
TTCTTCCAACGAGGAGGCACTCTACTTCTAGGTCAAGGTGCGGTGATCAC
GACAGCAGGAACGATTCCCACACCATCCTCAACACCAACGACAGTAGGAA
GTACTATAACTTTAAATCACATTGCCATTGACCTTCCTTCTATTCTTTCT
TTTCAAGCTCAGGCTCCAAAAATTTGGATTTACCCCACAAAAACAGGATC
TACCTATACTGAAGATTCCAACCCGACAATCACAATCTCAGGAACTCTCA
CCTTACGCAACAGCAACAACGAAGATCCCTACGATAGTCTGGATCTCTCG
CACTCTCTTGAGAAAGTTCCCCTTCTTTATATTGTCGATGTCGCTGCACA
AAAAATTAACTCTTCGCAACTGGATCTATCCACATTAAATTCTGGCGAAC
ACTATGGGTATCAAGGCATCTGGTCGACCTATTGGGTAGAAACTACAACA
ATCACGAACCCTACATCTCTACTAGGCGCGAATACAAAACACAAGCTGCT
CTATGCAAACTGGTCTCCTCTAGGCTACCGTCCTCATCCCGAACGTCGAG
GAGAATTCATTACGAATGCCTTGTGGCAATCGGCATATACGGCTCTTGCA
GGACTCCACTCCCTCTCCTCCTGGGATGAAGAGAAGGGTCATGCAGCTTC
CCTACAAGGCATTGGTCTTCTGGTTCATCAAAAAGACAAAAACGGTTTTA
AGGGATTTCGTAGTCATATGACAGGTTATAGTGCTACCACCGAAGCAACC
TCTTCTCAAAGTCCGAATTTCTCTTTAGGATTTGCTCAGTTCTTCTCCAA
AGCTAAAGAACATGAATCTCAAAATAGCACGTCCTCTCACCACTATTTCT
CTGGAATGTGCATAGAAAATACTCTCTTCAAAGAGTGGATACGTCTATCT
GTGTCTCTTGCTTATATGTTTACCTCGGAACATACCCATACAATGTATCA
GGGTCTCCTGGAAGGGAACTCTCAGGGATCTTTCCACAACCATACCTTAG
CAGGGGCTCTCTCCTGTGTTTTCTTACCTCAACCTCACGGCGAGTCCCTG
CAGATCTATCCCTTTATTACTGCCTTAGCCATCCGAGGAAATCTTGCTGC
GTTTCAAGAATCTGGAGACCATGCTCGGGAATTTTCCCTACACCGCCCCC
TAACGGACGTCTCCCTCCCTGTAGGAATCCGCGCTTCTTGGAAGAACCAC
CACCGAGTTCCCCTAGTCTGGCTCACAGAAATTTCCTATCGCTCTACTCT
CTATAGGCAAGATCCTGAACTCCACTCGAAATTACTGATTAGCCAAGGTA
CGTGGACGACGCAGGCCACTCCTGTGACCTACAATGCTTTAGGGATCAAA
GTGAAAAATACCATGCAGGTGTTTCCTAAAGTCACTCTCTCCTTAGATTA
CTCTGCGGATATTTCTTCCTCCACGCTGAGTCACTACTTAAACGTGGCGA
GTAGAATGAGATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy