Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR372 IGR368 IGR367 IGR371 CPn0465 CPn0464 CPn0461 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0465 CPn0464 CPn0461 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0464 CPn0461 CPn0463 CPn0462 CPn0465 CPn0467 pmpE, - CPn0466
* Calculated from Protein Sequence

Gene ID: CPn0465

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
533212

Gene Stop:
532868

Gene Length:
345

Molecular Weight*:
13240

pI*:
8.40

Net Charge*:
2.14

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits in gapped BLAST to hypothetical protein sequences in C.pneumoniae:

Residues 4-113 are 48% similar to residues 16-130 of Cpn0458.
Residues 1-113 are 45% similar to residues 1-118 of CPn0457.
Residues 1-113 are 44% similar to residues 1-118 of CPn0456.
Residues 1-106 are 47% similar to residues 1-111 of CPn0462.
Residues 6-113 are 41% similar to residues 7-119 of CPn0461.

Pfam Summary:  Pfam Search
Residues 19 to 114 (E-value = 1.3e-72) place CPn0465 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
49

PDB Hit:


Gene Protein Sequence:
MSYYFSLWYLKVQQHFQAAFDFTRSLCSRISNFALGVIALLPIIGQLYVG
LDWLLSRIKKPEFPSDVDQIVRVEHVVGHDHRSRVEDILKRQRLSLEPRD
EGKVHGDLPSAPFF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTATTACTTTTCTCTTTGGTATCTGAAGGTGCAACAGCACTTTCA
AGCAGCATTTGATTTTACTCGCTCCCTGTGTTCACGAATTTCTAATTTTG
CTTTGGGAGTGATTGCATTGCTTCCTATTATTGGGCAGTTGTATGTAGGG
CTGGACTGGCTCCTCTCTAGGATAAAAAAGCCAGAATTTCCTTCCGATGT
GGATCAGATCGTGCGAGTAGAACACGTCGTGGGTCACGACCATAGAAGTC
GAGTTGAAGATATTCTAAAGAGACAAAGGCTCTCATTAGAGCCTAGAGAC
GAGGGGAAGGTTCACGGAGATCTGCCTTCAGCTCCTTTTTTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy