Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR372 IGR368 IGR367 IGR371 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0464 CPn0460 CPn0463 CPn0462 CPn0465 CPn0461 CPn0467 pmpE, - CPn0466
* Calculated from Protein Sequence

Gene ID: CPn0464

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
532842

Gene Stop:
532363

Gene Length:
480

Molecular Weight*:
18443

pI*:
7.40

Net Charge*:
0.82

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae, except residues 10-77 are 35% similar to residues 138-205 of CPn0456.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LFSEGTALNLFRIFAPLRNRVTTEYSRARQPDLHRIAIVYIGVLDSESSK
ILERLISYMSCIYSESQMYLRFFMGKNVNQSAVLSKLHVENLHIRCGFFS
EDAVPESEPFDLSIYVHTDRSCPLPTKKRSSSWELQTVELPESIYPQSEF
LLMRPRMLS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTCTCTGAGGGGACAGCTCTAAATTTATTTCGTATATTTGCTCCACT
ACGCAACCGTGTGACTACAGAATACAGTCGTGCTAGGCAACCCGACCTAC
ATAGAATTGCCATCGTCTATATAGGAGTTCTCGATTCAGAAAGTTCCAAG
ATCCTAGAGCGGCTAATCTCTTATATGAGTTGTATCTATTCTGAATCGCA
AATGTATTTAAGATTCTTTATGGGCAAGAATGTAAATCAAAGTGCTGTAC
TCTCAAAATTACATGTAGAAAATCTGCACATCCGTTGTGGGTTTTTCAGC
GAGGATGCTGTTCCAGAGAGTGAGCCCTTCGATCTCTCCATCTACGTGCA
CACAGATCGTAGCTGTCCTCTCCCTACGAAAAAACGGAGCAGCTCCTGGG
AACTCCAAACTGTAGAACTCCCAGAGTCAATATATCCACAGTCGGAATTC
CTATTGATGAGACCTCGAATGCTTTCGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy