Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR372 IGR368 IGR367 IGR371 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0467 pmpE, - CPn0466 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0459 CPn0459 CPn0465 CPn0467 pmpE, - CPn0466
* Calculated from Protein Sequence

Gene ID: CPn0463

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
532357

Gene Stop:
531188

Gene Length:
1170

Molecular Weight*:
43839

pI*:
4.70

Net Charge*:
-21.60

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits in gapped BLAST to hypothetical protein sequences in C.pneumoniae:

Residues 22-223 are 38% similar to residues 59-265 of CPn0460.
Residues 37-318 are 35% similar to residues 349-612 of CPn0462.
Residues 9-381 are 27% similar to residues 331-688 of CPn0458.
Residues 105-386 are 33% similar to residues 5-283 of CPn0455.
Residues 37-214 are 335 similar to residues 340-522 of CPn0457.
Residues 8-98 are 42% similar to residues 303-393 of CPn0456.

Pfam Summary:  Pfam Search
Residues 101 to 243 (E-value = 1.7e-86) place CPn0463 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

PDB Hit:


Gene Protein Sequence:
MMKQGVGQDAKELYTFLSRGNEHYQPCLWFSLEEELGFLFDEKMLCAPLS
EDHYCHSYLVDLVDQHLKDLILSMFLDPQNISAGELLKVSINVGDSFSPL
QQKDFLSMVLRDETGKNVVVVFKGVLSLPATQVCKLVEELNSKDYSYLNI
FSCHGDSSPQLLFRKELEGTSGRYFTVICALYLGDTDMRSLQLASERIMV
SREFDLVDAYAARCKLLKIDHTNWRPGTFSRHADFADAVDVSAGFNSREF
KLITQANQGILESGELPLPSKTFWEGFLAFCDRVTVTRHFIPMLDAAIKQ
AVWTHKHPSLIDKECEALDLKTQCLPSIVSYLEYVTNSHEKTSKGPFIQK
EIIADCSPLKEALFPGSDEDVPSTSEDPSDDHPSDLEDS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAACAAGGAGTCGGGCAGGATGCTAAAGAGCTATACACATTTCT
ATCTCGTGGGAATGAGCATTACCAACCGTGTCTATGGTTCAGTCTCGAAG
AGGAACTCGGATTCCTTTTCGATGAAAAAATGCTCTGCGCCCCTCTATCT
GAGGATCACTATTGCCACTCGTATCTTGTAGATCTAGTGGATCAACATTT
AAAGGATTTAATATTATCGATGTTTTTAGATCCTCAGAATATCTCAGCAG
GAGAACTCCTCAAGGTCTCTATAAACGTTGGAGATTCTTTTTCTCCTCTA
CAACAGAAAGATTTCCTCTCGATGGTCTTACGTGATGAAACGGGAAAAAA
CGTCGTCGTGGTTTTTAAAGGAGTTCTCTCCTTACCCGCAACCCAAGTCT
GCAAATTAGTAGAGGAATTGAACTCTAAGGACTACTCCTACCTCAATATA
TTTTCTTGTCACGGAGATAGTAGTCCTCAGCTTTTATTCCGTAAGGAATT
AGAGGGAACTTCAGGGCGTTATTTTACAGTGATTTGCGCTTTATATCTAG
GGGATACAGACATGCGTAGTTTACAACTTGCTTCTGAAAGGATCATGGTC
TCTAGAGAGTTTGATCTTGTAGATGCCTATGCTGCAAGATGCAAGCTCTT
GAAAATCGATCATACAAATTGGAGACCTGGAACTTTCAGTCGCCACGCCG
ATTTCGCAGATGCTGTAGACGTATCAGCAGGATTTAACTCAAGAGAATTT
AAACTGATTACGCAGGCGAATCAAGGGATCCTAGAGTCTGGAGAACTCCC
GCTCCCTTCAAAAACCTTCTGGGAAGGATTCTTAGCATTCTGTGATCGAG
TGACTGTCACGAGACACTTCATTCCAATGTTAGACGCCGCTATAAAGCAA
GCGGTATGGACTCATAAACATCCCAGCTTGATAGATAAAGAGTGTGAAGC
CCTAGACTTGAAAACACAGTGCTTGCCATCTATCGTATCGTACCTTGAAT
ATGTCACAAACTCTCACGAAAAAACATCGAAAGGCCCGTTCATACAAAAA
GAGATTATCGCAGACTGTTCTCCTCTTAAAGAGGCGCTCTTCCCAGGTTC
TGATGAAGATGTTCCCTCTACCTCTGAGGATCCTTCAGATGATCATCCTT
CGGATCTTGAAGACTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy