Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR368 IGR365 IGR367 IGR371 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0458 pmpE, - CPn0466 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0458 pmpE, - CPn0466 CPn0464 CPn0461 CPn0460 CPn0463 CPn0462 CPn0458 CPn0459 CPn0459 CPn0465 pmpE, - CPn0466
* Calculated from Protein Sequence

Gene ID: CPn0462

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
531052

Gene Stop:
529034

Gene Length:
2019

Molecular Weight*:
75238

pI*:
5.20

Net Charge*:
-12.63

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 4-671 are 34% similar to residues 16-688 of CPn0458.
Residues 272-556 are 54% similar to residues 2-281 of CPn0460.
Residues 8-407 are 36% similar to residues 8-390 of CPn0456.
Residues 1-554 are 31% similar to residues 1-551 of CPn0457.
Residues 1-268 are 46% similar to residues 1-264 of CPn0461.
Residues 414-658 are 37% similar to residues 2-251 of CPn0455.
Residues 349-612 are 35% similar to residues 37-318 of CPn0463.
Residues 1-111 are 47% similar to residues 1-106 of CPn0465.
Residues 577-670 are 34% similar to residues 20-114 of CPn0459

Pfam Summary:  Pfam Search
Residues 19 to 119 (E-value = 2.1e-78) place CPn0462 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)
Residues 413 to 558 (E-value = 8e-95) place CPn0462 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
53

PDB Hit:


Gene Protein Sequence:
MACYISIWISTVKQHFIRAFDFTRPLGSRITNFALGVIKAIPILGCVVIG
VSWLVSTCSARRFGKPAFTSDVASIVKIEKTRGYNPLAWVEQYLRQLRVR
LPEGDLGKIHGKVSRDYVCDRTPQENLNMVPHQYLGELGRAFYGIRNRVT
KAYQRVTPLEVPCLTLVGFDILDPEDQVNFVRLANGIQTQYPQTQIKLYL
ISIQKIWNQCDGTISQEKEQQLRSLGLDAKIKCVSAPALLLQKYLQSENL
PSCDLLINYYGKQQSVRDVDSIKSLLNLSSEHIPAISVTYRPDDPFYSYY
FFPGSQGGTAPDQRIPWSEQEHLQTYTTLSNPRCDRYAVHLGMEDFASGV
FLDPLRVSAPLSGEYSCPSYLLDLKSEELRCFLLSAFIDPNNSGQGNPRP
MSINFGNSPLGQRWSEFLSRVLHDETEKHVAVVCNNPQLIKKSFPSHSLS
LLENELEESGYSYLNIVSVSQERTCVKERRILSSDPSGRSFTVILTDLPE
GSSDIRNLQLASDRILVSSALDAADACASECKILEYEDPEQEWAQQYASF
YRNIDRAGDLQRQGIPGEPLGVSASTRVVLEKDIVFNLNAVIQQAMWKFK
KRDLFAVESQALGDDMRRALEGYIGSSLLVEGTIQPQVACNVNVSFATLD
EAVCAACDSAQDAPSEENNTDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATGCTATATTTCTATTTGGATATCTACAGTTAAGCAGCATTTTAT
TAGGGCTTTTGATTTTACACGTCCTCTTGGTTCTCGGATTACAAATTTTG
CTTTGGGGGTCATCAAGGCTATTCCCATTTTAGGATGCGTTGTTATAGGG
GTAAGTTGGCTAGTTTCCACATGTTCTGCACGAAGGTTTGGGAAACCGGC
ATTTACTTCTGACGTTGCTAGTATCGTGAAAATAGAAAAAACTCGAGGTT
ATAATCCCCTTGCTTGGGTGGAACAGTACTTGAGACAGCTTAGGGTTCGA
CTTCCTGAAGGAGATTTAGGAAAAATCCATGGGAAGGTCTCCAGAGATTA
TGTTTGCGACAGGACTCCCCAAGAAAATCTGAATATGGTTCCTCATCAAT
ATCTGGGAGAGCTAGGTCGCGCGTTTTATGGAATCCGCAACCGAGTAACC
AAGGCGTATCAACGAGTCACTCCTCTGGAAGTCCCTTGTCTTACGCTCGT
CGGTTTTGACATTTTAGATCCCGAAGATCAGGTGAATTTCGTTCGTCTGG
CTAACGGCATACAAACTCAGTACCCCCAAACTCAAATAAAACTTTATTTA
ATCTCTATCCAAAAGATATGGAATCAGTGTGACGGTACGATTTCTCAAGA
AAAAGAACAGCAACTCCGCTCTCTAGGTTTGGATGCTAAAATCAAATGTG
TGTCGGCCCCCGCTCTCCTGCTCCAGAAATATCTTCAATCCGAGAACTTG
CCTTCCTGTGATCTTCTCATTAATTATTACGGGAAACAACAGTCCGTCAG
AGACGTGGACTCTATAAAGAGTCTACTCAATCTTTCTTCCGAACATATCC
CTGCGATTTCTGTAACCTATAGACCTGACGATCCTTTTTATAGCTACTAT
TTCTTTCCTGGTTCTCAAGGAGGAACGGCACCCGATCAGAGGATCCCTTG
GAGTGAGCAGGAGCATCTTCAAACGTATACCACCCTGTCTAACCCTAGAT
GTGATAGATATGCTGTTCACTTGGGAATGGAAGATTTTGCCTCTGGAGTA
TTTTTAGATCCTCTTAGGGTTTCGGCTCCTTTATCTGGAGAGTATTCCTG
CCCCTCATACCTCTTAGATTTAAAAAGTGAAGAGCTTCGTTGTTTCTTGT
TATCCGCTTTTATAGATCCCAACAATTCTGGTCAGGGAAATCCGCGTCCT
ATGTCCATAAACTTTGGAAACTCTCCTTTGGGTCAGAGGTGGTCTGAGTT
TCTATCTCGTGTTCTACATGATGAAACAGAAAAGCATGTGGCTGTAGTCT
GCAATAATCCACAACTTATAAAAAAGAGTTTTCCCTCACATTCTTTATCT
CTATTAGAGAACGAACTGGAAGAGTCAGGTTATTCTTATTTGAATATCGT
TTCAGTGAGTCAGGAACGCACGTGTGTTAAGGAACGTAGAATTTTAAGTT
CTGATCCTTCGGGGAGGTCATTCACTGTAATCCTCACTGATCTTCCTGAA
GGGAGTTCGGATATCCGCAACTTGCAGCTAGCGTCAGATAGGATCTTAGT
TTCTAGTGCTCTCGATGCTGCTGATGCCTGTGCTTCTGAATGTAAGATCT
TAGAATATGAGGATCCCGAGCAAGAGTGGGCGCAACAGTATGCGTCGTTC
TATAGAAACATCGACAGGGCAGGCGATCTTCAACGTCAGGGGATTCCAGG
AGAGCCTTTAGGGGTCTCAGCATCTACGAGAGTAGTTTTAGAAAAGGACA
TCGTATTCAATCTCAATGCGGTAATCCAACAGGCCATGTGGAAGTTTAAA
AAACGGGATCTTTTTGCTGTAGAAAGTCAGGCTTTAGGAGATGACATGCG
ACGTGCTTTAGAAGGTTATATCGGCAGCAGTCTCTTAGTTGAGGGGACTA
TACAGCCTCAAGTCGCATGTAATGTCAATGTGAGTTTTGCTACGTTAGAC
GAGGCTGTGTGTGCAGCTTGTGACTCAGCTCAAGATGCACCTTCTGAGGA
GAACAATACAGATGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy