Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR370 IGR368 IGR365 IGR364 IGR367 IGR371 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0465 CPn0464 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0464 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0459 CPn0459 CPn0465
* Calculated from Protein Sequence

Gene ID: CPn0461

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
528638

Gene Stop:
527841

Gene Length:
798

Molecular Weight*:
29448

pI*:
5.40

Net Charge*:
-8.06

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical proteins in C.pneumoniae:

Residues 6-264 are 46% similar to residues 5-268 of CPn0462.
Residues 6-264 are 39% similar to residues 5-263 of CPn0456.
Residues 4-261 are 39% similar to residues 15-270 of CPn0458.
Residues 6-261 are 34% similar to residues 5-256 of CPn0457.
Residues 7-119 are 41% similar to residues 6-113 of CPn0465.

Pfam Summary:  Pfam Search
Residues 20 to 120 (E-value = 1.3e-80) place CPn0461 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
52

PDB Hit:


Gene Protein Sequence:
VACPSISSWFTVVRQHFVNAFDFTHPVCSRITNFALGIIKAIPVLGHIVM
GIEWLISWIPRHTVRHGMFTSDVSSAIKVEQTRGHNCLAPLEAYLSSLRV
PISQEDLGKVHGRTPEDPFVDITPTEIVQLLPDEELSTVDEALQGVRSRL
TYAYRSVEKPMIQDLALVGFGLRDSADLINFVRLANGVQNHYPHTKVKLY
LAKNLADVWDCEISEEEKGQLRALGLDPKIESISLTSAGLPSVPEVATVD
FMITCYGKDQEVQDP$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTTGTCCAAGTATTTCTTCTTGGTTTACTGTCGTTCGACAGCATTT
TGTAAACGCCTTTGATTTCACCCATCCCGTTTGTTCTCGGATTACAAATT
TTGCTTTGGGGATCATTAAGGCAATTCCCGTATTAGGACACATTGTCATG
GGAATCGAGTGGTTGATTTCCTGGATTCCCAGACACACCGTTCGTCATGG
AATGTTTACTTCTGATGTCTCTAGTGCTATTAAAGTAGAACAAACACGGG
GTCATAATTGTTTAGCTCCCCTAGAAGCCTATTTAAGTAGCTTGAGAGTC
CCCATTTCCCAAGAAGATCTAGGCAAAGTACACGGGAGAACCCCAGAAGA
TCCCTTCGTAGATATCACACCCACAGAAATTGTCCAACTTCTCCCTGATG
AAGAACTCTCTACTGTAGATGAGGCACTGCAAGGCGTTCGTAGTAGGTTA
ACCTATGCCTATAGGTCCGTAGAGAAACCTATGATTCAAGATCTTGCTCT
TGTGGGTTTTGGTCTCCGAGATTCTGCGGACCTCATAAATTTCGTGCGTC
TTGCTAATGGCGTGCAGAATCACTATCCCCATACTAAAGTGAAGCTCTAT
TTAGCGAAGAACTTGGCAGATGTCTGGGACTGTGAAATTTCTGAAGAGGA
AAAAGGGCAACTCCGAGCTCTAGGTTTAGACCCTAAAATAGAGAGTATAT
CCCTTACGAGTGCAGGTCTTCCTTCAGTGCCAGAAGTCGCTACTGTCGAT
TTTATGATTACCTGTTACGGGAAAGATCAGGAAGTCCAAGATCCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy