Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR369 IGR368 IGR365 IGR364 IGR367 CPn0464 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0464 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0459 CPn0459 CPn0464
* Calculated from Protein Sequence

Gene ID: CPn0460

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
527840

Gene Stop:
526989

Gene Length:
852

Molecular Weight*:
32165

pI*:
5.50

Net Charge*:
-5.11

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18602.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 2-281 are 54% similar to residues 272-556 of CPn0462.
Residues 48-280 are 34% similar to residues 334-563 of CPn0458.
Residues 138-283 are 45% similar to residues 2-146 of CPn0455.
Residues 59-265 are 38% similar to residues 22-223 of CPn0463.
Residues 2-283 are 29% similar to residues 262-555 of CPn0457.
Residues 61-133 are 43% similar to residues 320-392 of CPn0456.

Pfam Summary:  Pfam Search
Residues 137 to 283 (E-value = 1.1e-93) place CPn0460 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
132  
215

PDB Hit:


Gene Protein Sequence:
VIQHLLNFALEETPSISVQYQEQEKLSPCDHSPEIGKKKRWNKLESFSTY
CSLFMSVKDHYKLNLGIQNSLSGWLLDPYRVCAPLSSPYSCPSYLLDLQN
KELRRSLLSTFLDPKNLTSETFRSVSINFGNSSFGQRWSEFLSRVLHDEK
EKHVAVVCNDAKLLEEGLSPEALSLLEEDLRESGYSYLNILSVSPEGVSK
VQERQILRRDLQGRSFTVMITDLPLGSEDIRSLQLASDRILVSSSLDAAD
ACASGCKVLVYENPNASWAQELENFYKQVERRR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATACAACATCTTCTAAACTTTGCTCTAGAAGAGACCCCTTCCATTTC
CGTGCAATACCAAGAACAAGAGAAGCTCTCTCCGTGCGATCATTCCCCAG
AAATAGGTAAAAAGAAAAGATGGAATAAGCTGGAATCCTTCTCCACGTAT
TGTTCTCTGTTTATGTCTGTTAAGGATCATTATAAGCTGAATCTAGGAAT
TCAGAATTCCCTGTCAGGGTGGCTTCTGGATCCCTATAGGGTTTGCGCGC
CTTTATCTTCACCGTACTCGTGTCCTTCCTATCTTTTAGATTTGCAAAAC
AAAGAGCTACGTCGTTCCCTTCTGTCAACGTTTCTAGACCCTAAAAATCT
CACTAGCGAAACATTCCGTTCTGTCTCTATAAACTTTGGCAACTCTTCGT
TTGGACAGAGATGGTCAGAGTTTCTATCTCGTGTTCTGCACGACGAGAAA
GAAAAGCACGTAGCTGTTGTTTGTAATGATGCAAAACTTCTGGAAGAAGG
ATTGTCCCCAGAGGCATTGTCTCTATTAGAAGAAGACTTAAGAGAATCAG
GGTATTCGTATCTAAACATTCTCTCGGTGAGCCCCGAAGGAGTCTCCAAG
GTTCAGGAACGTCAGATTCTAAGGCGAGATCTCCAAGGACGGTCCTTTAC
TGTCATGATTACAGATCTTCCTTTAGGTAGCGAAGATATCCGTAGTTTAC
AATTAGCCTCGGATAGGATTTTAGTCTCCAGTTCTCTTGATGCCGCGGAT
GCATGTGCTTCGGGATGTAAAGTCTTAGTCTACGAAAATCCAAATGCATC
CTGGGCTCAGGAATTGGAGAACTTCTACAAACAAGTTGAGAGAAGAAGGT
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy