Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR368 IGR365 IGR364 IGR367 IGR363 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0461 CPn0460 CPn0463 CPn0457 CPn0462 CPn0458 CPn0459 CPn0459
* Calculated from Protein Sequence

Gene ID: CPn0459

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
527005

Gene Stop:
526616

Gene Length:
390

Molecular Weight*:
14593

pI*:
4.60

Net Charge*:
-6.85

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18601.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Two significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 20-114 are 34% similar to residues 577-670 of CPn0462 (AAD18604).
Residues 12-110 are 31% similar to residues 576-677 of CPn0458 (AAD18600).
Residues 4-71 are 35% similar to residues 151-216 of CPn0455 (AAD18597).

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LREEGSVSFREYFRAYMCDKIVAQKNFLFTLDAVIKQAGWRSQEKLNLFY
VESQALGREIKVSLEEYIQSMVGILGSQRTKKSFKFSVDFTPLEQALQER
CSSDDDEDATATSTATGATASPTDMHEDE$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGAGAAGAAGGTAGTGTTTCTTTCAGAGAATATTTCAGAGCCTATAT
GTGTGATAAAATCGTGGCACAGAAGAACTTCTTATTTACTTTAGACGCTG
TAATTAAACAGGCCGGTTGGAGATCACAAGAGAAACTCAATTTATTTTAT
GTTGAAAGTCAGGCTTTAGGAAGAGAAATCAAAGTCAGCTTAGAGGAATA
TATTCAGAGTATGGTCGGGATTTTGGGATCTCAGAGAACCAAGAAAAGCT
TTAAGTTTTCTGTCGACTTTACCCCTTTAGAGCAGGCTCTACAAGAAAGA
TGCTCTTCTGATGATGACGAAGATGCAACAGCAACTTCGACCGCTACAGG
GGCAACAGCATCTCCGACTGACATGCACGAAGATGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy