Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR365 IGR364 IGR367 IGR363 CPn0461 CPn0460 CPn0456 CPn0457 CPn0462 CPn0458 CPn0461 CPn0460 CPn0456 CPn0457 CPn0462 CPn0458 CPn0461 CPn0460 CPn0456 CPn0457 CPn0462 CPn0458 CPn0459 CPn0455 CPn0459 CPn0455
* Calculated from Protein Sequence

Gene ID: CPn0458

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
526320

Gene Stop:
524233

Gene Length:
2088

Molecular Weight*:
78537

pI*:
5.20

Net Charge*:
-18.87

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This sequence can be found under GenBank accession AAD18600.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits in gapped BLAST to hypothetical proteins in C.pneumoniae:

Residues 17-594 are 38% similar to residues 5-582 of CPn0457.
Residues 16-688 are 34% similar to residues 4-671 of CPn0462.
Residues 17-416 are 40% similar to residues 5-389 of CPn0456.
Residues 12-270 are 39% similar to residues 1-261 of CPn0461.
Residues 334-563 are 34% similar to residues 48-280 of CPn0460.
Residues 16-130 are 48% similar to residues 4-113 of CPn0465.
Residues 426-676 are 27% similar to residues 5-273 of CPn0455.
Residues 331-688 are 27% similar to residues 9-381 of Cpn0463.

Pfam Summary:  Pfam Search
Residues 31 to 131 (E-value = 2.4e-82) place CPn0458 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)
Residues 421 to 566 (E-value = 2.1e-89) place CPn0458 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
5  
22
transmembrane  
46  
63
non-globular  
386  
443

PDB Hit:


Gene Protein Sequence:
LFVSNFIFFVVMPIPYISSWISTVRQHFVKAFDFSRPFCSRVTNFALGVI
KAIPIVGHIVMGMEWLVSSCVAGIITRSSFTSDVVQIVKTEKALGRDHIS
RVAEILQRERGTITPENQDKVHGKFPVCPFGRLKSEETLKLKPGEREGTL
DTVFSPIRTRVTRAYLQAPRPEIRTISIVGSKLKTPQDFSQFVSLANETQ
RLHPEALVCLYLTGLNRESQMCDTTTAEKKQYLHNSGLDSRIQCKDSKED
DAGSPENPELWIGYYSREQQHNIDGQYIQQCLGKSADPIPWIHVTEDTKD
FYYPPNFTSYSHTRQSTDPTSPPRLPESEGDKDSLYGQLSRSYHHEYMLG
LGLKPEDAGLLMDPDRIYAPLSQGHYCHSYLADIENEDLRTLVLSPFLDP
GNLSSEDLRPVAFNIARLPLELDSLFFRLVAGQQEGRNIVTLAHGTPRPE
DLDPDSMNILTRRLQMSGYSYLNIFSYKSRKMIVKERQFFGDRSEGKSFT
LILFEDPISAADFRCLQLAAEGMVAKDLPSVADICASGCSCIQFSEMQSP
QAIEYRQWEARVEDEAGEEAREPVIYSQDQLSSMLTTQQNFVFSLDAVVK
QAIWRFRSKGLLTMERKALGEEFLTAIFSYLGSQERNENMGKRTTEEHEV
VISFEELDRMVQVLPAEVPADSGNDPTRPVPNPDSNPDSSQNEGS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTGTTTCTAATTTTATTTTTTTTGTTGTTATGCCAATTCCCTATAT
TTCTTCTTGGATTTCTACCGTTCGACAGCATTTTGTTAAGGCGTTTGATT
TCTCTCGTCCCTTTTGTTCTAGGGTTACGAATTTTGCTTTAGGGGTCATC
AAGGCCATCCCTATTGTAGGACATATTGTCATGGGGATGGAGTGGTTAGT
TTCTTCCTGTGTTGCCGGGATTATTACTAGGTCCTCCTTTACCTCAGATG
TCGTTCAGATTGTAAAGACTGAGAAGGCGTTAGGTCGAGATCATATATCT
CGAGTGGCGGAGATATTGCAAAGAGAAAGGGGGACCATAACTCCTGAGAA
TCAAGATAAGGTGCATGGGAAGTTTCCTGTCTGTCCTTTTGGTCGTTTAA
AATCCGAGGAAACTTTAAAACTTAAGCCGGGAGAAAGAGAGGGAACTTTA
GATACTGTATTTTCTCCGATTCGCACGCGCGTGACTCGTGCGTACTTACA
GGCCCCCCGACCCGAAATACGTACGATTTCTATTGTGGGTTCGAAACTTA
AAACTCCTCAAGATTTCTCGCAATTTGTGAGTCTCGCGAATGAAACGCAG
AGACTGCATCCTGAAGCGTTAGTTTGTCTGTATTTGACAGGCTTGAATCG
CGAATCTCAGATGTGCGATACAACTACTGCAGAGAAGAAGCAGTACCTAC
ATAACTCAGGTCTCGACTCTAGAATCCAGTGCAAAGACAGTAAAGAAGAC
GACGCTGGCTCTCCTGAAAATCCCGAACTTTGGATTGGCTATTATTCACG
AGAGCAACAGCATAATATAGACGGGCAGTATATTCAGCAGTGTCTAGGGA
AGAGTGCAGATCCAATTCCTTGGATTCATGTTACTGAAGACACAAAGGAT
TTTTATTACCCACCAAACTTTACTTCATACTCACATACAAGACAATCTAC
AGACCCAACATCGCCACCAAGACTCCCTGAAAGTGAGGGGGATAAGGATT
CCTTGTACGGACAACTGAGTCGATCGTATCACCATGAGTATATGCTTGGT
TTGGGATTAAAACCAGAGGATGCAGGACTCCTGATGGACCCGGATAGAAT
CTATGCTCCTCTATCCCAAGGGCATTATTGTCATTCCTACCTTGCGGATA
TAGAAAATGAGGATCTACGAACTTTAGTCCTTTCGCCTTTCCTAGATCCT
GGCAATCTTAGTAGCGAGGATCTTCGTCCTGTAGCATTCAATATCGCTAG
ATTGCCATTAGAATTGGACTCGTTATTTTTCCGCCTTGTTGCGGGTCAGC
AAGAAGGGAGAAACATAGTTACCCTTGCCCACGGAACTCCTCGTCCAGAA
GATCTTGATCCTGACTCAATGAACATTCTGACCAGAAGATTACAAATGTC
TGGATATAGCTATTTGAACATTTTCTCCTATAAATCACGGAAAATGATTG
TAAAAGAACGTCAGTTCTTTGGAGATCGTTCTGAAGGGAAGTCTTTCACA
TTGATCTTATTTGAGGATCCCATTAGTGCAGCAGATTTCCGTTGTTTGCA
GCTAGCTGCAGAAGGTATGGTTGCTAAGGATCTCCCCAGCGTAGCAGATA
TTTGTGCCTCTGGATGTTCCTGCATTCAGTTTTCTGAGATGCAGAGTCCT
CAGGCTATTGAATATAGACAATGGGAGGCACGTGTCGAAGATGAAGCAGG
AGAAGAAGCCAGAGAACCAGTAATTTATTCTCAGGATCAATTGAGCAGCA
TGCTCACTACACAACAGAATTTTGTATTTTCTCTAGATGCTGTGGTAAAA
CAGGCGATCTGGAGATTCCGTTCGAAAGGTCTTCTTACTATGGAAAGAAA
GGCACTAGGCGAGGAGTTCTTAACTGCGATATTTTCCTATTTAGGGAGTC
AGGAGCGTAATGAGAATATGGGGAAAAGAACTACCGAAGAACATGAGGTC
GTTATCAGCTTCGAAGAGCTAGATCGCATGGTGCAAGTCCTCCCAGCCGA
AGTCCCTGCAGATTCAGGCAATGATCCTACGCGTCCCGTTCCTAATCCAG
ATAGTAACCCTGATTCCTCGCAAAATGAAGGCAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy