Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR365 IGR362 IGR364 IGR363 CPn0461 CPn0460 CPn0456 CPn0457 CPn0458 pmpH, - CPn0454 CPn0461 CPn0460 CPn0456 CPn0457 CPn0458 pmpH, - CPn0454 CPn0460 CPn0456 CPn0457 CPn0458 CPn0459 CPn0455 CPn0455 CPn0459 CPn0461 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0457

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
523865

Gene Stop:
522117

Gene Length:
1749

Molecular Weight*:
66510

pI*:
6.00

Net Charge*:
-9.94

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18599.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 5-582 are 38% similar to residues 17-594 of CPn0458.
Residues 1-395 are 37% similar to residues 1-387 of CPn0456.
Residues 1-551 are 31% similar to residues 1-554 of CPn0462.
Residues 5-256 are 34% similar to residues 6-261 of CPn0461.
Residues 1-118 are 45% similar to residues 1-113 of CPn0465.
Residues 262-55 are 29% similar to residues 2-283 of CPn0460.
Residues 340-522 are 33% similar to residues 37-214 of CPn0463.
Residues 422-580 are 26% similar to residues 18-174 of CPn0455.

Pfam Summary:  Pfam Search
Residues 19 to 119 (E-value = 1.4e-77) place CPn0457 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)
Residues 404 to 555 (E-value = 2.7e-99) place CPn0457 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
279  
339
coil-coil  
523  
566

PDB Hit:


Gene Protein Sequence:
MASCLSAWFSIVREHFYRAFDFSLPFCARITEFVLGVIKGIPVVGHIIVG
IEWLVSRYLESFVTKPTFVSDVVSLLKTEKVAGRDHIARVVETLKRQRVA
VAPEDEDKVHGKIPVHPFGGIQPVEVLTLYPEVQDATLGLAFSKIRNRVR
QAYLQAPRPKLQKIYIIGNDMNPFEVDDFLHLARLCNETQRLYPDATISL
YLTASGGRNAMDKKNRKLLSDCELNPKIACLDFNQGDVVKQATCDCWMVY
HGENDQGTLNQIQEELEKSGEETPWIHVGQKPLSQSLWDFSPFSSLEMKG
DKEKALEYSELEKEQLYSRLVYVGERSSVLSLGFGDSRSGILMDPKRVHA
PLSEGHYCHSYLADLENPGLQKTILAAFLNPKELSSTILQPISLNLILNS
KTYLRQHFGFFERMSRSDRNVVVVVCDSWWGTDWKEEPSFQHFIMELECR
GYSHFNIFAFRSNSMCVEERRILNESSQEKAFTMIFCEDSVSQGDIRCLH
LASEGMLCGKECYAVDVYTSGCANFMMEEVLTLERESNLWNRKHGLWKRE
VRKQKQEAALDQDESEIYVCNQLTAQQNFACS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTCTTGTTTATCTGCCTGGTTTTCTATAGTTCGTGAGCACTTTTA
TCGAGCCTTTGATTTTTCTTTGCCGTTTTGTGCTCGTATTACGGAATTTG
TATTAGGGGTCATCAAGGGGATCCCTGTTGTGGGTCACATTATTGTTGGG
ATAGAGTGGCTCGTTTCTAGGTATTTAGAGAGTTTCGTGACCAAGCCGAC
ATTTGTCTCTGATGTGGTGAGTCTTCTGAAAACAGAGAAAGTTGCTGGTC
GCGATCACATTGCTCGTGTAGTGGAGACTTTGAAGAGGCAGAGAGTCGCT
GTGGCTCCTGAAGATGAGGATAAGGTCCATGGGAAGATTCCTGTGCATCC
TTTCGGGGGAATCCAACCTGTAGAAGTTCTCACTCTCTATCCCGAAGTTC
AAGATGCAACGTTAGGGCTTGCCTTCTCTAAAATTCGTAATCGTGTAAGA
CAGGCGTATTTGCAAGCTCCACGGCCAAAACTGCAGAAGATTTACATCAT
AGGAAACGATATGAATCCTTTTGAAGTTGACGACTTCTTGCATCTAGCCC
GTCTCTGTAATGAAACTCAAAGACTCTATCCTGACGCTACGATTTCTCTA
TATCTAACAGCTTCTGGTGGTCGCAATGCTATGGACAAAAAGAATCGGAA
GTTACTTAGTGATTGCGAACTAAACCCCAAGATTGCTTGTTTGGACTTTA
ATCAGGGTGATGTAGTCAAACAAGCAACTTGTGACTGTTGGATGGTGTAT
CATGGGGAGAATGATCAAGGTACGTTGAATCAGATTCAGGAAGAGTTAGA
AAAGTCAGGGGAGGAAACCCCTTGGATTCATGTGGGGCAAAAGCCTCTTT
CACAATCCTTGTGGGATTTCTCTCCATTTTCATCTTTGGAGATGAAGGGA
GATAAAGAGAAAGCTCTAGAGTACTCTGAATTAGAAAAAGAACAGCTATA
TTCTCGATTGGTATACGTAGGAGAGCGCTCTTCGGTTCTTAGTTTGGGGT
TTGGAGATAGTCGGTCAGGGATCTTGATGGACCCAAAACGGGTGCATGCT
CCCTTATCTGAAGGGCATTATTGTCATTCCTACCTTGCAGACTTAGAAAA
TCCCGGGTTACAAAAAACAATTTTAGCGGCATTTCTGAATCCTAAGGAGT
TGAGCAGTACCATACTGCAACCTATATCTCTAAATCTTATCTTAAATAGC
AAAACTTACTTAAGGCAGCACTTTGGCTTTTTTGAGAGGATGAGCAGAAG
TGATCGCAATGTGGTTGTCGTTGTATGTGATTCTTGGTGGGGTACCGACT
GGAAGGAGGAGCCAAGCTTCCAACACTTTATTATGGAGCTAGAGTGTCGA
GGGTATTCGCACTTCAATATTTTTGCCTTTAGATCTAATAGCATGTGTGT
AGAAGAACGTAGGATCTTAAATGAAAGTTCTCAAGAGAAAGCCTTTACCA
TGATTTTCTGTGAGGATTCAGTATCTCAAGGAGATATCCGCTGTTTGCAT
TTGGCGTCTGAAGGAATGCTTTGTGGTAAAGAGTGCTATGCTGTCGATGT
CTATACGTCAGGATGCGCGAACTTTATGATGGAAGAAGTCTTAACTTTGG
AGCGAGAATCTAATCTGTGGAATAGAAAGCATGGTCTTTGGAAAAGAGAA
GTTAGAAAACAGAAACAAGAAGCTGCTTTGGATCAAGACGAGAGCGAGAT
TTACGTTTGTAATCAGCTGACGGCGCAACAGAACTTCGCTTGTTCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy