Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR361 IGR362 IGR364 IGR363 CPn0456 CPn0457 CPn0458 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 CPn0458 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 CPn0458 CPn0455 CPn0455 pmpG, - CPn0453 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0456

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific conserved hypothetical protein

Gene Start:
521532

Gene Stop:
520324

Gene Length:
1209

Molecular Weight*:
45385

pI*:
7.20

Net Charge*:
1.74

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18598.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits in gapped BLAST to hypothetical sequences in C.pneumoniae:

Residues 5-389 are 40% similar to residues 17-416 of CPn0458.
Residues 8-390 are 36% similar to residues 8-407 of CPn0462.
Residues 1-387 are 37% similar to residues 1-395 of CPn0457.
Residues 5-263 are 39% similar to residues 6-264 of CPn0461.
Residues 1-118 are 44% similar to residues 1-118 of CPn0465.
Residues 303-393 are 42% similar to residues 8-98 of CPn0463.
Residues 320-392 are 43% similar to residues 61-133 of CPn0460.

Pfam Summary:  Pfam Search
Residues 19 to 119 (E-value = 3.9e-82) place CPn0456 in the DUF575 family which is described as Protein of unknown function (DUF575) (PF04746)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
50
coil-coil  
87  
116
non-globular  
313  
359

PDB Hit:


Gene Protein Sequence:
MTHCLHGWFSVVRHHFVQAFNFSRPLYSRITHFALGVIKAIPIVGHLVMG
VDWLISHCFERGVSHPGFPSDIAPILKVEKIAGRDHISRIENQLKSLRKT
IEVEDLDKVHGQYQENPYADMASSEVLKLDKGVHVSELGKAFSRVRNRIT
RSYSYAPTPQLDSIAIVGIDLVSPEEQENLVRLANEVIQLYPKSKTTLYL
LIDFNKEWVGDISSDKEKQLRSLGLHSEVQCLSVLEPQGAEGEDTKHFDL
MVGCYGKDSYLREGKILQQALGTSLGTVPWVNVMHTLPSRYRSRLSLPIN
TEKDKTELYKEISRTHHQLHTLGMGLGAQDSGLLLDRQRLHAPLSQGSHC
HSYLADLTHEELKILLFSAFVDAKNISKKELREVSLNFANDTSVECGCAF
YF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCATTGCTTACATGGTTGGTTTTCTGTAGTTCGTCATCACTTTGT
GCAGGCGTTTAATTTCTCACGTCCTTTATATTCTCGAATTACCCACTTCG
CTTTAGGGGTGATTAAGGCCATCCCCATTGTAGGGCATCTTGTTATGGGA
GTCGATTGGTTGATCTCTCATTGCTTCGAGAGGGGAGTCTCACACCCTGG
GTTCCCTTCAGATATTGCTCCTATACTGAAAGTAGAAAAGATCGCGGGCC
GAGATCATATTTCTAGAATCGAAAATCAGCTAAAGAGCCTTAGGAAAACT
ATCGAGGTTGAAGATCTAGATAAAGTCCACGGGCAATATCAAGAGAATCC
TTATGCAGATATGGCCTCTAGTGAGGTTCTTAAACTCGATAAGGGAGTTC
ATGTTAGCGAGCTTGGCAAAGCCTTTTCTAGAGTTCGCAATCGCATCACC
AGATCCTATAGTTATGCCCCTACTCCTCAGTTGGACTCTATAGCTATTGT
TGGTATAGATCTCGTCAGTCCTGAAGAACAAGAGAATTTAGTACGCTTGG
CGAATGAGGTCATTCAACTCTATCCCAAATCAAAGACAACTCTATATCTT
CTTATCGATTTTAATAAGGAGTGGGTAGGGGATATCTCCTCTGATAAGGA
AAAACAGCTCCGTTCTCTAGGTCTACATTCTGAAGTTCAGTGTCTTTCCG
TCTTGGAACCTCAGGGTGCCGAGGGCGAAGATACGAAACACTTTGACCTT
ATGGTCGGCTGTTATGGGAAGGATTCTTACTTAAGGGAGGGTAAAATTTT
ACAGCAGGCCCTAGGGACTTCGTTAGGTACTGTTCCCTGGGTGAATGTTA
TGCACACATTGCCATCTAGGTATAGATCTCGGCTTTCCTTACCTATAAAT
ACCGAAAAGGATAAGACAGAGCTTTATAAAGAGATTTCTCGTACACACCA
TCAGTTGCATACTTTGGGAATGGGACTTGGAGCCCAGGATTCAGGATTGC
TCTTAGACCGGCAACGACTCCATGCTCCTTTATCTCAAGGGTCTCACTGC
CATTCCTATCTTGCAGATCTCACCCATGAAGAGCTGAAAATTTTGTTATT
TTCAGCATTTGTGGATGCTAAGAACATAAGTAAGAAAGAGCTTCGTGAGG
TATCTCTAAATTTTGCTAACGATACTTCCGTAGAGTGTGGCTGCGCTTTT
TACTTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy