Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR361 IGR362 IGR364 IGR363 CPn0456 CPn0457 CPn0458 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 CPn0458 pmpG, - CPn0453 pmpH, - CPn0454 CPn0456 CPn0457 CPn0458 CPn0455 CPn0455 pmpG, - CPn0453 pmpH, - CPn0454
* Calculated from Protein Sequence

Gene ID: CPn0455

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
520348

Gene Stop:
519455

Gene Length:
894

Molecular Weight*:
32988

pI*:
4.20

Net Charge*:
-28.04

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several probable paralogs found in C.pneumoniae, all of which are hypothetical proteins:

Residues 2-251 are 37% similar to residues 414-251 of CPn0462.
Residues 2-146 are 45% similar to residues 138-283 of CPn0460.
Residues 5-273 are 27% similar to residues 426-676 of CPn0458.
Residues 5-283 are 33% similar to residues 105-386 of CPn0463.
Residues 18-174 are 26% similar to residues 422-580 of CPn0457.

Pfam Summary:  Pfam Search
Residues 1 to 146 (E-value = 2.9e-92) place CPn0455 in the DUF562 family which is described as Protein of unknown function (DUF562) (PF04763)

PDB Hit:


Gene Protein Sequence:
VWLRFLLLVSYDEKEKDVVVVCNHSEPNILGLPPEAVSQLIEELSDEGYS
YLNVVRCDLSGETTVQQRLLLNADEGRSMTVVISELPEGHPDIRNLQLAS
ERIFVSREKEAADAYASGCKVVAFDDEHLPWVSSHIAYAEEIREKQEQTM
QGSLTEEQLGALLCNTVSTEKNLAFALDAVIKQSVWRFRNPDLFAYEREA
LEASVTDALVSYVSNLDMIPYTSSQGIVIEDSSIVRTSQEHTLIVNCAAF
DKLASQIEFLCPSDVLPISGKDPLISDDEDEELNPKVSSAADSKDKT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGGCTGCGCTTTTTACTTTTAGTGTCCTATGATGAGAAGGAGAAAGA
CGTAGTTGTCGTTTGTAATCATTCTGAACCTAATATCCTCGGCCTGCCTC
CTGAAGCAGTCTCTCAGCTTATTGAAGAGCTTAGCGATGAAGGCTATAGC
TATCTGAATGTAGTGCGTTGTGATCTCTCCGGGGAGACTACGGTTCAACA
ACGTCTGCTATTGAATGCCGATGAAGGGAGATCTATGACGGTGGTGATCT
CAGAGCTTCCTGAAGGGCACCCCGATATTCGGAATTTGCAGTTGGCATCC
GAAAGAATTTTTGTTTCTCGTGAAAAAGAAGCTGCTGATGCCTATGCTTC
AGGATGTAAAGTGGTCGCTTTCGATGATGAGCATCTCCCTTGGGTCTCCA
GTCATATTGCCTACGCGGAGGAGATCAGAGAGAAACAAGAACAAACAATG
CAAGGGTCTTTAACTGAAGAGCAGTTAGGAGCACTCCTCTGCAACACAGT
CTCCACAGAGAAAAATCTAGCCTTTGCTCTAGACGCCGTGATAAAACAGT
CTGTGTGGAGATTCCGCAATCCGGATCTTTTTGCTTATGAGAGAGAAGCT
CTAGAGGCTTCAGTAACAGATGCTTTAGTATCTTACGTTTCAAATTTAGA
CATGATACCGTACACAAGTTCTCAGGGCATAGTCATAGAAGATAGTAGTA
TCGTCCGTACCTCTCAAGAGCATACACTCATTGTGAACTGTGCAGCATTC
GATAAGTTAGCGAGCCAAATAGAGTTCTTATGCCCCAGTGACGTGTTGCC
CATTTCTGGTAAAGACCCTTTGATTTCTGATGATGAGGATGAGGAACTGA
ATCCTAAAGTTTCATCTGCTGCAGACTCTAAAGATAAAACCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy